KEGG   Bacillus subtilis subsp. subtilis 168: BSU05240
Entry
BSU05240          CDS       T00010                                 

Symbol
ydeL
Name
(RefSeq) GntR family transcriptional regulator
  KO
K00375  GntR family transcriptional regulator / MocR family aminotransferase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU05240 (ydeL)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   GntR family
    BSU05240 (ydeL)
SSDB
Motif
Pfam: GntR Aminotran_1_2 HTH_11 HTH_36 HTH_24 RPA_C HTH_Crp_2 Fe_dep_repress HTH_50
Other DBs
NCBI-GeneID: 939904
NCBI-ProteinID: NP_388405
Pasteur: BG12139
BSORF: BG12139
UniProt: P96669 A0A6M4JDN4
Position
571389..572780
AA seq 463 aa
MDITPFLNRTLDIPLYQQLYRYFKENMHRGRIQKGMKLPSKRLLANQLSISQTTVERAYE
QLAAEGYIVSKPRSGWFADYHDSDFAYDRMPSTTPIQQEAEENKQWIDFHYGNVDSSYFP
FSAWRKSMVNSLDQYGHELYRPGHVLGEFELRTLIAEYLYQSRGVHCGPEQVIIGAGNPI
LLQILCQVFEPNISIGYEDPGYPRARKIFEANRMNIVPIPVDDEGICIQKIKEQQPNLVY
VTPSHQFTLGTIMTINRRIQLLKWAAENQSFIIEDDYDGEFRYTGQPVPSLQGLDQHNRV
IYMGTFSKSLLPSLRISYMILPSPLLKKGHEITSLYKQTVSCHSQLTLAEFIKNGEWQKH
INRMRKLYRKKRAIVLEAVQRELGEHVRIRGENSGLRILLDVYLPFGEKELIEKAKKHGV
KIYPVSLSYQHHPPTKTVSLGFAGVSESDIREGIKKLKAAWKI
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggatatcacgccttttttgaatagaactctggatattccgctttatcagcagctttat
cggtattttaaagaaaatatgcatcggggccgtattcaaaaaggaatgaagcttccttca
aaaagactcctggcgaatcagctttccatcagccaaacgactgtagaacgtgcctatgaa
cagctcgctgctgaaggttatattgtgagcaagccaagaagcgggtggtttgctgattat
catgattctgattttgcttatgatagaatgccaagcacaacacccattcaacaagaagca
gaagaaaataaacaatggattgattttcattatgggaatgtagattcttcttacttccct
ttttccgcatggcgaaaaagcatggtcaatagcttagaccaatatggacacgagctttat
cggccgggacatgttttaggagagtttgagctgagaacactcattgcagagtacctgtat
caatctcggggggttcattgcggccctgaacaagtgattataggtgccgggaaccctatt
ctgctgcaaatcttgtgccaagtttttgagccgaatatttctatagggtatgaggatcct
ggttatccaagagcacgcaagatttttgaagccaaccgcatgaatattgttcctatacca
gtcgatgatgagggaatctgtatacagaagatcaaagaacagcagccaaaccttgtatat
gtcacaccttcccatcaatttacgctgggaaccataatgacaataaacagaagaattcag
ctgctcaaatgggcggccgaaaatcaatcctttatcatagaggatgattatgacggggaa
tttaggtacacaggacagccggttccttctctgcaagggcttgatcagcataaccgtgtc
atttatatgggcactttttctaagtctcttttgccctcgctgcgtatcagctatatgatt
cttccttcgcctcttttaaaaaagggtcatgaaatcacgtccttatataagcagacagtg
tcctgccacagtcagctaaccctagctgaatttataaaaaatggagagtggcaaaaacac
atcaacagaatgagaaaactttaccgcaaaaaaagagccattgtattagaggcagtgcaa
agggaattaggagagcatgtcagaatccgcggagaaaactctgggcttcgtatcttactt
gacgtttatttgccatttggtgaaaaagagttaattgagaaggcgaaaaaacatggagta
aaaatttatcctgtttctctttcttatcaacatcatcctcctacaaaaacggtctcgctc
gggtttgcaggggtttctgaatccgacataagagaaggcataaaaaaactgaaggctgcc
tggaagatatga

DBGET integrated database retrieval system