KEGG   Bacillus subtilis subsp. subtilis 168: BSU05250
Entry
BSU05250          CDS       T00010                                 

Symbol
ydeM
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MaoC_dehydratas MaoC_dehydrat_N
Other DBs
NCBI-GeneID: 938104
NCBI-ProteinID: NP_388406
Pasteur: BG12140
BSORF: BG12140
UniProt: P96670 A0A6M3Z7S1
Position
572974..573399
AA seq 141 aa
MKLDEFTIGQVFKTKSLKVSKDDIMRFAGEFDPQYMHVDEEKASKGRFNGIIASGIQTLA
ISFKLWIEEGFYGDDIIAGTEMNHMTFIKPVYPDDELFTIVEVLDKQPKRNELGILTVLL
STYNQKEVKVFEGELSVLIKR
NT seq 426 nt   +upstreamnt  +downstreamnt
atgaagttagatgagtttacaattggccaggtcttcaaaacgaaatcattaaaagtatca
aaagatgatattatgcggtttgcgggtgaatttgaccctcagtatatgcatgtagatgaa
gaaaaagcgagtaaaggcagatttaatggaattatcgcttccggcatacaaacactggcc
atatcttttaaactttggattgaagaaggtttctatggagacgatattatagccggaaca
gagatgaatcatatgacattcataaaacccgtatatccggatgatgaattgtttacaatt
gttgaggttcttgataagcagccaaagagaaatgaattgggaatactcacagtattgcta
tctacttataatcaaaaagaagtaaaagtgtttgaaggtgagttatctgtattgatcaaa
cgataa

DBGET integrated database retrieval system