KEGG   Bacillus subtilis subsp. subtilis 168: BSU05260
Entry
BSU05260          CDS       T00010                                 

Symbol
ydeN
Name
(RefSeq) hydrolase
  KO
K07002  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU05260 (ydeN)
SSDB
Motif
Pfam: Ser_hydrolase Abhydrolase_6 DUF900 LCAT Abhydrolase_2 FSH1
Other DBs
NCBI-GeneID: 939908
NCBI-ProteinID: NP_388407
Pasteur: BG12141
BSORF: BG12141
UniProt: P96671 A0A6M3ZB12
Structure
Position
complement(573452..574024)
AA seq 190 aa
MTKQVYIIHGYRASSTNHWFPWLKKRLLADGVQADILNMPNPLQPRLEDWLDTLSLYQHT
LHENTYLVAHSLGCPAILRFLEHLQLRKQLGGIILVSGFAKSLPTLQMLDEFTQGSFDHQ
KIIESAKHRAVIASKDDQIVPFSFSKDLAQQIDAALYEVQHGGHFLEDEGFTSLPIVYDV
LTSYFSKETR
NT seq 573 nt   +upstreamnt  +downstreamnt
atgacaaaacaagtctatatcattcatggctacagagcctcctcaacaaatcattggttc
ccttggctgaaaaaacgtctgctcgcagatggggtccaagcagacattttaaacatgcct
aatccgctccagccaagacttgaggattggctggatacactctctttatatcagcacact
ttacatgaaaatacgtatttggttgcgcacagcttaggttgccccgccattttgagattt
ttggaacatcttcaattacgaaaacagcttggcggaatcatacttgtttccggctttgcc
aaatcattgcccactttacagatgttagatgaatttacacagggatcgtttgatcatcaa
aaaatcatcgagtccgcgaagcaccgtgctgtcattgcttctaaggacgaccaaattgtg
cctttttcattcagcaaggatctggcacaacaaattgatgctgcgttatatgaagttcag
cacggaggtcattttctagaagatgagggatttacttctttgcctattgtttatgatgtt
ttaacctcttatttttcaaaggaaacccgctaa

DBGET integrated database retrieval system