KEGG   Bacillus subtilis subsp. subtilis 168: BSU05270
Entry
BSU05270          CDS       T00010                                 

Gene name
ydzF
Definition
(RefSeq) HxlR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HxlR MarR PadR
Other DBs
NCBI-GeneID: 938088
NCBI-ProteinID: NP_388408
Pasteur: BG12809
BSORF: BG12809
UniProt: O31494 A0A6M4JD82
Position
complement(574106..574435)
AA seq 109 aa
MNSLCRSKQAPFEYTLSLIGGKWKMRILYELGCEKTMRYGELKRAMPFITHKMLSAQLKE
LQTDGLIHRSEVSHTPLKVEYSLSDRGRSLYPLIDEMCKWGMAQGGPHM
NT seq 330 nt   +upstreamnt  +downstreamnt
atgaatagcctgtgccgcagtaaacaagccccatttgaatacaccttatctcttataggg
ggcaaatggaaaatgagaattctctatgagttagggtgtgaaaaaacgatgagatacggc
gagctgaaaagggctatgcccttcatcacccataaaatgttaagcgcacagcttaaggaa
ttgcaaactgacggccttattcatcggtctgaggtttctcacaccccactgaaagtagag
tattcgttatctgacagagggcgatctttgtatcccctcatagatgagatgtgtaagtgg
ggaatggcacaaggagggcctcatatgtaa

DBGET integrated database retrieval system