KEGG   Bacillus subtilis subsp. subtilis 168: BSU05290
Entry
BSU05290          CDS       T00010                                 

Symbol
ydeP
Name
(RefSeq) HxlR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HxlR PadR
Other DBs
NCBI-GeneID: 938100
NCBI-ProteinID: NP_388410
Pasteur: BG12143
BSORF: BG12143
UniProt: P96673 A0A6M3Z8E6
Position
complement(575712..576098)
AA seq 128 aa
MRNRKLGIDYSSDDFEGCPVETTLDIIGGKWKGILLYHLIDGKKRFNEFRKLYPKITQRM
LTLQLRELERDGVIHREVYKQVPPKVEYSLTEFGRTLEPVILHMKDWGEKYKDRIDKLEA
ARKAEDKI
NT seq 387 nt   +upstreamnt  +downstreamnt
ttgagaaatcgtaaactcggcattgattattcttctgatgactttgaaggatgtccggtg
gagacaacattagatatcatcggaggtaagtggaaaggcattcttctttatcatctcatt
gacggtaaaaagaggtttaatgagtttcgaaaactatacccaaaaattacccagcgtatg
ctcacgctacaattaagagaattggaacgggatggcgtgattcaccgcgaggtttataaa
caggtccctccaaaagtcgaatactctttaactgagtttggaagaacattagaacctgtt
atcctgcacatgaaggactggggagaaaaatataaagacaggattgataagctcgaagca
gcacgtaaagctgaagataaaatctaa

DBGET integrated database retrieval system