KEGG   Bacillus subtilis subsp. subtilis 168: BSU05300
Entry
BSU05300          CDS       T00010                                 

Symbol
ydeQ
Name
(RefSeq) NAD(P)H oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Flavodoxin_2 FMN_red
Other DBs
NCBI-GeneID: 939902
NCBI-ProteinID: NP_388411
Pasteur: BG12144
BSORF: BG12144
UniProt: P96674 A0A6M4JFV4
Position
576209..576802
AA seq 197 aa
MDHMKTLVLVVHPNIESSRINKKWKEAVLSEPDVTVHDLYEKYRDQPIDVEFEQQQLLAH
DRIVFQFPLYWYSSPPLLKQWFDEVFTFGWAHGPGGNKLKGKEWVTAMSIGSPEHSYQAG
GYNLFSISELTKPFQASAHLVGMTYLPSFAEYRANTISDQEIAESANRYVKHITNIELNP
KVRLQRYLKQLESVDLT
NT seq 594 nt   +upstreamnt  +downstreamnt
atggatcatatgaaaacactcgtactcgttgtacatccgaatatagaatcctctcgtatc
aataaaaagtggaaagaagccgttttaagtgaaccagatgtaactgtccatgatctttat
gaaaaatatcgcgatcaaccaattgatgtggaatttgaacaacagcagctcctggcccat
gaccgtatcgtttttcagtttccattatactggtacagcagcccaccgcttttaaaacag
tggtttgatgaagtgtttacgtttggctgggctcatggtcccggcggaaataaattgaag
gggaaagagtgggtaactgccatgtccatcggttcacctgaacactcttatcaagccggc
ggatataacttgttttcgataagcgagctgacaaaaccgttccaagcatctgcccattta
gtaggcatgacctatctgccttcctttgccgaatatcgcgccaatacaatcagtgaccaa
gaaattgccgaaagtgcgaatcggtatgtaaagcatattacaaatatagaattaaacccg
aaggttcgcctgcaaaggtatttgaaacagctggagagtgtcgatttaacataa

DBGET integrated database retrieval system