KEGG   Bacillus subtilis subsp. subtilis 168: BSU05310
Entry
BSU05310          CDS       T00010                                 

Symbol
ydeR
Name
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-GeneID: 938096
NCBI-ProteinID: NP_388412
Pasteur: BG12145
BSORF: BG12145
UniProt: P96675 A0A6M3Z7T6
Position
complement(576946..578133)
AA seq 395 aa
MANGNKQAGQRISPSLTLLLATACGIIVANLYYAQPLVGLISKAIGLSPSGAGLIVTLTQ
IGYVAGLLFLVPLGDIIENKKLIVVSLLLSAAALTLTAFVKHGTLFLAAAFFVGLGSIAA
QVLVPFASYLASDAARGRVVGNVMSGLLLGIMLSRPISSLVADIWGWNAIFALSAVVSVI
LAIVLSKVLPARKPTANTNYTALLGSMWKLLRTTPVLRRRAIYHAFVFGAFSLFWTTVPL
LLSGPDFHFSQKAIALYALVGIAGAVTAPIGGRLADRGLTRLATGIALGVVVVSLLLPLM
IQSSSPVGITVLVAAAILLDMGVSANLVLSQRAIFSLAPEIRSRLNGLFMAIFFLGGAIG
SSIGGWAYASGGWSTALWIGIAFPVIALLYFITEK
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggctaatggaaacaaacaagcaggtcagaggatttcacccagtttaacccttcttctc
gcaactgcatgcggtatcattgttgctaatctttactatgcacaacccttggtcggatta
attagtaaggcaattggactttctccaagcggtgctggattgattgtcacactcacccaa
atcggatacgttgccggcttactattccttgtccctttaggagatattatcgaaaacaaa
aaacttattgttgtatcgctccttctaagcgcagcggctttgacactaacagcatttgtg
aagcatggaacactgtttttagcagctgcgtttttcgtcggattgggatcaatcgcagcc
caagtgcttgttccatttgcatcataccttgcatcagacgctgcacgcggccgggttgtt
ggcaatgtcatgagcggcttattactcggtattatgctttcccgtccgatatctagtcta
gtcgctgatatctgggggtggaatgcaatattcgctttgtccgccgtggtaagtgttatc
ctggccatcgtattatcaaaagtgcttcctgccagaaaaccaacagcaaatacaaactat
actgccttactcggttcaatgtggaagctgctgcgcacgactccagtcttacgccgccgt
gccatctatcatgcgtttgtatttggagctttcagcttgttctggacaactgttccttta
ttattgtccggtcctgattttcatttttctcagaaggcaatagcactctacgcattggtg
ggcattgcgggtgcagtcactgcaccaataggcggccgcctggctgatcgaggcttaacc
aggcttgccactggaatcgctctcggtgttgtcgttgtctctttattactgccgctcatg
attcagagcagctcccccgtcggtataacagttctagtggccgctgctattctgttagat
atgggtgtatctgcaaaccttgtgctcagtcaacgtgctattttttcgttggcgcctgaa
attcgcagtcgattaaacggattattcatggcgatcttctttctaggcggtgcgataggg
tcatcaattggaggatgggcatatgcctcaggcggatggagtacagcattatggattgga
atcgcttttccggtcatcgctttgctttatttcatcacagagaaataa

DBGET integrated database retrieval system