KEGG   Bacillus subtilis subsp. subtilis 168: BSU05320
Entry
BSU05320          CDS       T00010                                 

Symbol
ydeS
Name
(RefSeq) TetR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TetR_C_11 TetR_N HTH_Tnp_1_2 HTH_7 HTH_11 TrmB HTH_23 HTH_17 HTH_22 TetR_C_10 HTH_32 HTH_29
Other DBs
NCBI-GeneID: 938083
NCBI-ProteinID: NP_388413
Pasteur: BG12146
BSORF: BG12146
UniProt: P96676 A0A6M3Z7R7
Position
578337..578933
AA seq 198 aa
MQSKRGRPRDEGTHKAILSAAYDLLLEKGFDAVTVDKIAERAKVSKATIYKWWSNKAAVI
MDSFLSTATDRLPVPDTGSSVQDIVTHATNLARFLTSREGTVIKELIGAGQLDEKLAEEY
RTRFFQPRRLQAKGLLEKGIQKGELRENLDIEVSIDLIYGPIFYRLLITGDEVNDSYVRD
LVMNAFKGVQATSATESM
NT seq 597 nt   +upstreamnt  +downstreamnt
gtgcagagtaaacgagggcggccgcgtgatgaaggaacgcataaggcgattctctctgca
gcctatgacctattgctggaaaaaggcttcgatgcggtgacagtcgataaaattgccgag
cgtgcgaaagtgagtaaagcaacgatttataaatggtggtctaacaaggctgccgttatc
atggacagctttctttcgaccgcgacggacaggctgcctgtgcctgatacagggtcgtca
gtacaagatatagtaacccacgccacgaatttagctaggtttttgacaagccgggaagga
accgttattaaggaattaataggtgcagggcagttggatgaaaaattggcagaagaatat
cgcacgcgatttttccagcctcgccgcctccaagcgaaaggccttctagaaaagggaatt
cagaaaggtgaattgagagagaatcttgatattgaagtaagcatagatctcatttacgga
ccaattttctatcgtctgcttataacaggggatgaggtgaatgattcctatgtgcgtgat
ttggtgatgaatgcgtttaagggagttcaagctacctctgctacagagagtatgtag

DBGET integrated database retrieval system