KEGG   Bacillus subtilis subsp. subtilis 168: BSU05329
Entry
BSU05329          CDS       T00010                                 

Symbol
ydzO
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303150
NCBI-ProteinID: YP_003097684
UniProt: C0H3V9
Position
579047..579232
AA seq 61 aa
MSKKKSFNREYITSYYYIPFHRLEQGFYTSMEYRKVGVFKQQGKIDGHYVGVMAMEKILA
M
NT seq 186 nt   +upstreamnt  +downstreamnt
atgtcgaaaaagaagtcattcaatcgtgaatacataacatcatattattacattcctttt
catcgattggaacaagggttctatacttcaatggaataccgcaaagttggagtatttaaa
caacaggggaaaatcgatggccattatgtaggtgtcatggcaatggaaaaaatacttgca
atgtaa

DBGET integrated database retrieval system