KEGG   Bacillus subtilis subsp. subtilis 168: BSU05330
Entry
BSU05330          CDS       T00010                                 

Symbol
aseR
Name
(RefSeq) ArsR family transcriptional regulator
  KO
K03892  ArsR family transcriptional regulator, arsenate/arsenite/antimonite-responsive transcriptional repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU05330 (aseR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   ArsR family
    BSU05330 (aseR)
SSDB
Motif
Pfam: HTH_5 HTH_20 MarR MarR_2 HTH_34 Sigma70_r4 UPF0122 HTH_24 HTH_27 TrmB BLACT_WH Rrf2 HTH_Crp_2 HTH_1
Other DBs
NCBI-GeneID: 938089
NCBI-ProteinID: NP_388414
Pasteur: BG12147
BSORF: BG12147
UniProt: P96677 A0A6M3Z7X2
Position
579541..579876
AA seq 111 aa
MTIDVAAMTRCLKTLSDQTRLIMMRLFLEQEYCVCQLVDMFEMSQPAISQHLRKLKNAGF
VNEDRRGQWRYYSINGSCPEFDTLQLILHQIDQEDELLNHIKQKKTQACCQ
NT seq 336 nt   +upstreamnt  +downstreamnt
atgacgattgatgttgcggcgatgactcgttgtttgaaaacacttagtgatcaaactagg
cttatcatgatgagattatttcttgaacaagaatattgtgtctgtcaattggttgatatg
ttcgaaatgagccagcccgccataagccagcatttgcggaaattaaaaaacgcaggtttt
gtgaatgaggacagaagaggccaatggcgttattattcaataaatggttcctgtcctgag
tttgatacattgcaattgatcttacatcaaattgatcaagaggatgaattgttaaaccat
atcaaacaaaagaaaactcaagcgtgttgccagtaa

DBGET integrated database retrieval system