KEGG   Bacillus subtilis subsp. subtilis 168: BSU05340
Entry
BSU05340          CDS       T00010                                 

Symbol
ydfA
Name
(RefSeq) arsenic pump protein
  KO
K03893  arsenical pump membrane protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU05340 (ydfA)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU05340 (ydfA)
SSDB
Motif
Pfam: ArsB CitMHS
Other DBs
NCBI-GeneID: 939905
NCBI-ProteinID: NP_388415
Pasteur: BG12148
BSORF: BG12148
UniProt: P96678 A0A6M4JDP1
Position
579889..581196
AA seq 435 aa
MTSMILAVFIFLLTLVLVIWQPKNLSIGWSACGGAVLALIAGVVNFHDVLTVTGIVWNAT
LAFVAIILISLILDNIGFFEWAALHMAKAAKGYGVRMFVYVSLLGAIVAALFANDGAALI
LTPIVLAMVRALHFNEKLVFPFIIASGFIADTTSLPFVVSNLVNIVSADYFHITFIDYAS
RMVVPYLFSLLASIIVLYLFFRKSIPKRYDLTEVKKPVEAIKDQNMFRLSWYILGLLLIG
YFASEFFSIPVSVVAGSIAIIFLIAAQKSPAVHTKKVVKEAPWAIVFFSIGMYVVVYGVR
NAGLTDVLSDVIQAAADQGLFAGTIGMGFIAAILSSIMNNLPTVMIDALAIAGTDTHGMM
REALIYANVIGSDLGPKITPIGSLATLLWLHVLSHKGMKISWGTYFKTGIILTIPTLLIT
LVGLYIWLLIIHSCF
NT seq 1308 nt   +upstreamnt  +downstreamnt
ttgacatcaatgattttggcagtattcatctttttattaactctagtattggtcatatgg
cagccgaaaaatttatctatagggtggtcagcctgtggaggcgcagttttagctctaata
gcaggtgttgtcaattttcatgatgtgttaactgtgacagggattgtttggaatgcgacc
ttggcttttgtggccatcatactgatatcgttaattcttgataatatcggtttctttgaa
tgggcagcgcttcatatggctaaggctgcaaaaggatacggtgtgcggatgttcgtttat
gtatctctattaggagctatcgtcgccgcgttatttgcaaatgacggtgcagctcttata
ttgacaccaatcgtattagcgatggtcagagcattacattttaatgaaaaattagttttt
ccttttatcattgccagcggatttattgcggataccacttcgcttccttttgtagtaagc
aatttggtcaacattgtttcagcggactattttcatattacgtttattgattatgcatcc
agaatggttgtcccgtacctgttttcgctgctggcgagcatcattgtactttaccttttc
tttagaaaaagcataccaaaacgctatgatctgactgaggttaaaaaacctgttgaagca
attaaagatcaaaacatgttcagactgtcatggtatatcttagggctgctgttaattgga
tattttgcaagtgaatttttttctatccctgtatcagtggtagcgggcagcattgcaatc
attttcttaatcgctgcgcaaaagagtccggccgtccatacaaagaaagtggtgaaagag
gcgccatgggctatcgtattcttttcaattggcatgtacgttgttgtgtatggtgtccga
aatgccggattaacggatgtcctttcagatgtgattcaagccgcagctgatcaaggattg
tttgctgggacaattggaatgggctttattgcggcgattctttcttccattatgaataac
ttgccgactgttatgattgacgcattggccattgccggtacagatacacatgggatgatg
agagaagcgcttatttatgcaaatgtgatcggttcagatttagggcctaaaataacaccg
attggttccttagcgacattattatggcttcatgttctttcgcacaaaggtatgaagatt
tcctggggcacgtattttaaaacaggaattatcctcacgatacccactttattgatcaca
cttgtcggcctgtatatttggctgctgataatccattcttgtttctaa

DBGET integrated database retrieval system