KEGG   Bacillus subtilis subsp. subtilis 168: BSU05350
Entry
BSU05350          CDS       T00010                                 

Symbol
ydfB
Name
(RefSeq) N-acetyltransferase YdfB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GNAT_acetyltran Acetyltransf_3 Acetyltransf_1 FR47
Other DBs
NCBI-GeneID: 938079
NCBI-ProteinID: NP_388416
Pasteur: BG12149
BSORF: BG12149
UniProt: P96679 A0A6M3ZM23
Position
581694..582479
AA seq 261 aa
MSVLQELTKKKYSSLKTMFDDKYCPTFVYSILDQTIPGAVYADDQTFPKSFFIGTESGIY
FIAGDQGNRDFHDFIAGYYEEQVKSSKRFTLFSSSDTWDSVLKPILKDDLNQMRRAAFSY
QPKSFKKTLQLPKGLVLKRIDEDIISHSTAFNSAYYEEYWNSVSQFASKGFGFAVLHGNH
VVSECTSIFLGHNRAEMDIYTLEEYRGLGLAYCVANRFIAFCMENGIVPSWDCDICNNSS
IALAAKLGFKTVTEYTIYYSG
NT seq 786 nt   +upstreamnt  +downstreamnt
ttgtctgttttgcaggaattaacaaaaaaaaaatacagtagcttaaaaacaatgtttgat
gacaaatattgtcccacatttgtctattcaatattagaccaaaccattccgggagctgtt
tatgcagatgatcaaacctttcctaaatcgttttttataggaactgaatcaggcatttat
tttattgcgggagaccaagggaatcgggattttcatgatttcattgcaggatattatgaa
gaacaagtgaaatcatcaaaacgatttaccttgttttcttccagtgatacatgggatagc
gtactgaaacccatactgaaagatgacttaaaccaaatgagaagagctgcattttcttat
caaccaaaatctttcaaaaagactttgcaactgccaaaggggcttgtattgaaaagaatt
gacgaagacatcatttcacatagcacagcgtttaacagcgcgtattatgaggagtattgg
aattctgtctcacagtttgcttcaaaaggttttggatttgccgtattacatggcaatcac
gtagtaagtgagtgtacctctatatttttagggcataatcgagcggaaatggatatctat
acacttgaagaatatagaggactggggttagcttattgcgtagcaaataggtttatagcg
ttttgtatggaaaatgggattgttcctagctgggattgtgatatttgcaacaattcgtcc
attgcattagcagctaaactagggtttaagacggtaacggaatacactatttactactct
ggctaa

DBGET integrated database retrieval system