KEGG   Bacillus subtilis subsp. subtilis 168: BSU05360
Entry
BSU05360          CDS       T00010                                 

Symbol
ydfC
Name
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: EamA TPT UAA CdaA_N
Other DBs
NCBI-GeneID: 938086
NCBI-ProteinID: NP_388417
Pasteur: BG12150
BSORF: BG12150
UniProt: P96680 A0A6M3Z7S8
Position
complement(582536..583456)
AA seq 306 aa
MRKKTVQIMISHSLMIGLWASAFPGIRAGLEGYTPEHLALFRLLIGSMALLLFAVLTQMR
LPDLKDIPAIFLLGFLGFAFYHILLNIGEKTVSAGVASLLVTTAPIFSAMLSRLFYKEHF
GFTKWLGSMISLLGVLLIAFGAGDFTYSMSGILVILLAAFSESIYFVFQARYIKKYGFIP
FVTFTIWGGTIPMLVFLPGLGEEMMNASISATLSIVYLGLLPTVIPYFALAYVTSFVGAS
EATLSLYVTPALALIISWLWIGEIPTLLSLLGGVVTVGGVCFTYLKVNKMNKIFITHFSA
KRVKKL
NT seq 921 nt   +upstreamnt  +downstreamnt
atgcgaaagaaaacagttcaaataatgatatctcatagtctcatgattggtttatgggca
tctgcttttccgggaattcgcgcaggacttgaagggtacacgccagaacaccttgcttta
tttcgtttgttaatcggctctatggcattattgctttttgctgttttgactcagatgcgc
ctacccgacttgaaagacattcctgccatttttcttttagggtttttaggatttgcattc
tatcacattttgctgaacatcggtgaaaaaacagttagtgccggagttgcaagcttactc
gttactacggcaccgatcttctcagccatgctatcccgcctgttttataaagagcatttt
ggatttacgaaatggcttggctctatgatcagtttattgggtgtattattgattgcattt
ggggcgggagactttacatattcaatgagcggtatcttggtcatcctgctggcagcattt
tcggagagtatttatttcgtttttcaagcccgctatataaaaaaatatggttttattcca
ttcgttacattcaccatttggggcggaacaatacctatgcttgtgtttctgccaggctta
ggcgaagagatgatgaacgcttcaataagcgcaactttgtctatcgtttacttaggatta
ttgccgacggttattccttacttcgcactagcatatgtcacttcattcgtcggtgcttca
gaagcaaccctttcactttatgttacaccggctttagccttgatcatatcttggctctgg
atcggcgagatacccacactgctctctctgctaggcggagtggttacagttggcggggta
tgttttacctacctaaaagtaaataaaatgaataagattttcatcacccatttttctgct
aaaagggtaaaaaaactctaa

DBGET integrated database retrieval system