KEGG   Bacillus subtilis subsp. subtilis 168: BSU05380
Entry
BSU05380          CDS       T00010                                 

Symbol
ydfE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Flavin_Reduct Putative_PNPOx
Other DBs
NCBI-GeneID: 939898
NCBI-ProteinID: NP_388419
Pasteur: BG12152
BSORF: BG12152
UniProt: P96682 A0A6M4JD93
Position
complement(585155..585778)
AA seq 207 aa
MDIKKQDTRRFKEIKPKIMYYGTSTFLLTTLNEDGTTNISPMSSSWALGHYIILGVGLGG
KAIDNLERHKECVINLPGPDLWENVERISSYSGKKSIPPLKKQIGFTYKKEKYEAAGLTP
LQSKTVSPTRIKECPIQIEAEVKHIRLPEYESSFAIVETQALHFHAEESIILDENHINPS
KWSPLIYNFRHYFGLGREVGKTFRSET
NT seq 624 nt   +upstreamnt  +downstreamnt
ttggacatcaaaaaacaagacactcgtcgatttaaggaaatcaaacccaagatcatgtat
tatggtacctcgacatttcttctaaccacattgaatgaggatggaaccactaatattagt
cctatgtcttcttcttgggctcttggacattatataatccttggagtaggactgggagga
aaagccatcgacaatttggaaagacacaaagagtgtgtcataaacttgcctggcccggat
ttatgggaaaacgttgaaagaatttcatcttatagcggaaaaaagagtataccgccttta
aagaagcagatcggatttacatataaaaaagaaaaatacgaggcagcagggttaacgcct
ttacaatcaaaaacagtatcaccaacacgaattaaagaatgccctatccaaatcgaagcc
gaagtgaaacacattcggcttccagaatatgaatcgtcattcgcaattgtagagacgcag
gcactacattttcatgccgaggaaagtatcattctggacgaaaaccatatcaacccttcc
aaatggagcccgcttatctataatttcagacactactttggtttaggaagagaagtcgga
aagacttttcgttcagagacatga

DBGET integrated database retrieval system