KEGG   Bacillus subtilis subsp. subtilis 168: BSU05390
Entry
BSU05390          CDS       T00010                                 

Symbol
ydfF
Name
(RefSeq) ArsR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_20 HTH_5 MarR_2 MarR HTH_Crp_2
Other DBs
NCBI-GeneID: 938084
NCBI-ProteinID: NP_388420
Pasteur: BG12153
BSORF: BG12153
UniProt: P96683 A0A6M3ZD31
Position
585868..586548
AA seq 226 aa
MNPNIAKISSLLSDPSRSSILLSLMDGRIHPAGELAYLANIKPQTASFHLNKLLEAKLIS
VEKHGRHRYYRLADSDAANVIEQLLHIAPKAKVKSLKESKEKKDLHFARTCYDHLAGYVG
VQMAHSLVEQGMLKKVDLNFEVTSEGALFFSKLGINEEQQRNKRRAFARCCLDWSERQHH
IAGALGNALLVRMLEEEWIVRMPKTRAIRITQSGKIAFEKHLNVKI
NT seq 681 nt   +upstreamnt  +downstreamnt
atgaatcctaatattgcaaaaatctcttcgttgctatcagatccctcgcgttcttccatt
cttctcagtctgatggatggaaggatacaccctgcgggagagcttgcatatctcgctaac
attaaacctcaaactgcaagttttcacctgaataaattgcttgaagcaaagctgattagc
gtagagaagcatgggagacatcggtattacagattggctgactcagatgctgcaaatgtg
atcgaacaattgcttcatattgcgcctaaagcaaaagtcaaatctttaaaagagtcaaaa
gagaaaaaggacttgcatttcgcccggacctgttatgatcatttggcaggttatgtgggc
gtgcaaatggcacattcactagttgagcaggggatgttaaaaaaagttgatttaaacttt
gaggtgacttcagagggtgctttattcttttcgaagttaggcatcaatgaagagcaacaa
cggaataagaggagagcctttgcccgctgctgtttggattggagtgaacggcagcatcat
attgcaggagcattaggaaacgccctattggtgcgcatgttagaagaagaatggatcgtt
cgtatgcctaaaacgagagcgattaggattacacaaagcgggaaaatcgcgtttgaaaag
cacctaaacgtgaagatttag

DBGET integrated database retrieval system