KEGG   Bacillus subtilis subsp. subtilis 168: BSU05400
Entry
BSU05400          CDS       T00010                                 

Symbol
ydfG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: CMD
Other DBs
NCBI-GeneID: 938081
NCBI-ProteinID: NP_388421
Pasteur: BG12154
BSORF: BG12154
UniProt: P96684 A0A6M4JFC8
Position
complement(586628..587071)
AA seq 147 aa
MSQRVSYYEIAPEGMKIMMDMEKYTKQSSINRTTRELIKIRVSQMNGCAFCIDMHTSDAR
KMGETEQRIYCLHAWNECDFYSPEEKAALELSEHITLIPSKRVPDELYHRVREHYDEEQY
VDLVLIINQINSWNRISIAMGNRAASK
NT seq 444 nt   +upstreamnt  +downstreamnt
atgagtcaaagagtgtcctactatgagattgcacctgaaggtatgaaaatcatgatggat
atggagaaatacacgaaacaatcctcaattaaccgaacgacgagagaactaatcaaaatc
agagtctctcaaatgaacggctgtgccttctgcatagatatgcatacgtccgatgcccgc
aaaatgggagaaactgaacagcgaatttactgtttacatgcttggaatgaatgtgatttt
tactcacctgaagagaaagcggctctcgaactatctgaacacatcacgctcattccatct
aaaagggttcctgatgagctatatcatcgggtgcgggaacattatgatgaggaacaatat
gttgaccttgttctgatcattaatcaaataaacagttggaaccgcatctctattgcaatg
gggaatcgagctgcttcaaaataa

DBGET integrated database retrieval system