KEGG   Bacillus subtilis subsp. subtilis 168: BSU05408
Entry
BSU05408          CDS       T00010                                 

Symbol
ydzP
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acyl_transf_3 DUF1275 PrgI SdpI
Other DBs
NCBI-GeneID: 8302941
NCBI-ProteinID: YP_003097685
UniProt: A0A6M3Z8A7
Position
complement(587157..587336)
AA seq 59 aa
MNMYWFLGALLYFLIGTYIFIRVTRDSQSGSWILLALAAPLIIAGYPYFYSKKLLSKRR
NT seq 180 nt   +upstreamnt  +downstreamnt
atgaacatgtattggtttctaggtgctttattatattttctgatcggtacttatatattc
attagagtcactagagacagccaatcaggctcatggatactgcttgcattagcagctcca
ctcatcattgctggctacccttatttttattcaaagaagcttctttccaaaagacgctga

DBGET integrated database retrieval system