KEGG   Bacillus subtilis subsp. subtilis 168: BSU05409
Entry
BSU05409          CDS       T00010                                 

Symbol
ydzQ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303032
NCBI-ProteinID: YP_003097686
UniProt: C0H3W1 A0A6M4JFS2
Position
complement(587333..587476)
AA seq 47 aa
MKSIDLTILSLKRKGIRTEKVLKNQNPDRLSHMTDKNAQPKSKEKEE
NT seq 144 nt   +upstreamnt  +downstreamnt
ttgaaatcgattgatctcacaattttatcattaaagagaaaaggaatccggaccgaaaag
gtattaaaaaatcagaaccctgatcgattaagccatatgacagacaaaaatgcgcaacca
aaaagcaaggaaaaagaggaatga

DBGET integrated database retrieval system