KEGG   Bacillus subtilis subsp. subtilis 168: BSU05410
Entry
BSU05410          CDS       T00010                                 

Symbol
ydfH
Name
(RefSeq) sensor histidine kinase
  KO
K11623  two-component system, NarL family, sensor histidine kinase YdfH [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU05410 (ydfH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU05410 (ydfH)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU05410 (ydfH)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU05410 (ydfH)
Protein kinases [BR:bsu01001]
 Histidine kinases
  NarL family
   BSU05410 (ydfH)
Two-component system [BR:bsu02022]
 NarL family
  YdfH-YdfI
   BSU05410 (ydfH)
SSDB
Motif
Pfam: HisKA_3 HATPase_c HATPase_c_2 TgpA_N SRP40_C HATPase_c_3 FYVE_2 DUF2015 THDPS_N_2 dCache_2
Other DBs
NCBI-GeneID: 938076
NCBI-ProteinID: NP_388422
Pasteur: BG12155
BSORF: BG12155
UniProt: P96685 A0A6M3Z7S5
Position
587744..588967
AA seq 407 aa
MLIRNPFKDKYYSHDRRALNMLALRVPGLAFILMIYIASIVLQFVSGGWSILLLYAFTIL
IAIFALLHWHSYRWVKKRVILYFAVQGLITFALANLMTGFFILVIIGLYAFLIGQIIGMA
DRRRTFLILYLLLLLVINSAYHLHKGEVLHFIVIAAPIMIVIITYAATFFAQVDEKIKAQ
LTLERLELAHQQVEQLTLQNERQRMARDLHDTLAQGLVSLNMQLDAIHVHLAKGNTERAK
EIIQQSMKRVKSTIADARSAIDDLRSKSEEIGVLKERITSLMDHFIESTGMACLLDYRLH
QVLDVRTAENCYYIIGECMTNAAKHAEAKTIWISIWDDEKGRLHLTVKDNGKGFDVEKGK
KKRGHYGLLGIQERVRAINGQFNIKSTKLKGTQIEITVPIQGEMQDE
NT seq 1224 nt   +upstreamnt  +downstreamnt
ttgcttataaggaatccttttaaagataaatattactcacatgataggcgggcattaaac
atgcttgcactcagagtgccgggcctggcttttattctcatgatctatatagcctctatc
gtgctgcaatttgtttctgggggctggtccattttattgctttatgcgtttaccatatta
atcgccatttttgctttgcttcattggcactcatatcgctgggttaagaaaagagtgatt
ctgtatttcgcggtacaaggtttgatcacctttgcacttgctaatctcatgactggcttc
tttatacttgtgattatcggcctttatgcatttttaattggacaaattataggaatggca
gacagaagaaggacttttctcattctttatctattgctgctgctggtcataaattcggcg
tatcaccttcataaaggtgaagttttgcattttattgttattgctgcgccgatcatgatt
gtcatcatcacttatgccgcaacattttttgcccaagtcgatgaaaaaataaaagctcaa
ttgactcttgaaaggctggagctggctcatcagcaggtagaacagctgacgctgcagaac
gaaagacagcggatggcccgagacttacacgatacgcttgctcaaggtcttgtcagttta
aatatgcagctggatgcgattcatgttcatctcgccaaaggcaacacagagagagcgaag
gaaatcatacaacaatcgatgaaaagagtgaaaagcacaatagctgatgcacgttcagct
attgacgatctccgcagcaaatcagaagaaatcggtgttttaaaagaaagaattacctcg
ctaatggatcattttatagagtcgacaggcatggcttgtttattagattacagattgcat
caggtgctggatgtgcgtacagctgaaaactgttattacatcattggagaatgcatgacg
aatgcggcaaagcatgctgaggcgaaaacaatctggatatccatttgggatgatgaaaag
ggaaggctccatttaacagttaaggataacggcaagggatttgatgttgaaaaaggaaag
aaaaagagaggacattatgggcttcttggcatacaagaacgcgtcagggcaataaatggc
caattcaatatcaagagtacaaaattgaaaggaacacaaattgagatcactgtaccaatt
cagggagagatgcaagatgaataa

DBGET integrated database retrieval system