KEGG   Bacillus subtilis subsp. subtilis 168: BSU05420
Entry
BSU05420          CDS       T00010                                 

Symbol
ydfI
Name
(RefSeq) transcriptional regulator
  KO
K11624  two-component system, NarL family, response regulator YdfI
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU05420 (ydfI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU05420 (ydfI)
Two-component system [BR:bsu02022]
 NarL family
  YdfH-YdfI
   BSU05420 (ydfI)
SSDB
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_23 DUF2089 Sigma70_ECF HTH_10 HTH_11 Sigma70_r4
Other DBs
NCBI-GeneID: 938080
NCBI-ProteinID: NP_388423
Pasteur: BG12156
BSORF: BG12156
UniProt: P96686 A0A6M4JGS4
Position
588960..589601
AA seq 213 aa
MNKVLIVDDHLVVREGLKLLIETNDQYTIIGEAENGKVAVRLADELEPDIILMDLYMPEM
SGLEAIKQIKEKHDTPIIILTTYNEDHLMIEGIELGAKGYLLKDTSSETLFHTMDAAIRG
NVLLQPDILKRLQEIQFERMKKQRNETQLTEKEVIVLKAIAKGLKSKAIAFDLGVSERTV
KSRLTSIYNKLGANSRTEAVTIAMQKGILTIDN
NT seq 642 nt   +upstreamnt  +downstreamnt
atgaataaggttttaatcgttgatgaccatcttgtcgtgagggaaggtctgaagctttta
attgaaacgaatgatcaatacaccattataggagaggcggaaaatggaaaagtagcagtc
cgtcttgcagatgaattagaaccggatatcattctgatggatttgtatatgccggagatg
agcgggttagaggccattaaacaaataaaagaaaaacacgatacccccatcattattttg
actacatataatgaagatcacttaatgatcgaagggattgaattaggagcgaaaggatat
ctgttaaaagatacgagttcagaaaccctttttcacacaatggatgcagccatcagagga
aatgtgctattgcagcctgatatccttaaacgtctgcaagaaatccaatttgagcggatg
aaaaagcagcgcaatgagacgcagctgacagaaaaggaagtcattgttctaaaagcaatt
gctaaaggtcttaaaagcaaagcgattgcctttgatttgggcgtctctgagcgaacagta
aagtccagattaacgtccatttacaataaattaggcgcgaattcaagaactgaggcagta
acgattgccatgcaaaaaggtattctgacaatagacaactaa

DBGET integrated database retrieval system