KEGG   Bacillus subtilis subsp. subtilis 168: BSU05430
Entry
BSU05430          CDS       T00010                                 

Symbol
ydfJ
Name
(RefSeq) hypothetical protein
  KO
K11625  membrane protein YdfJ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU05430 (ydfJ)
SSDB
Motif
Pfam: MMPL Sterol-sensing Patched DUF6688
Other DBs
NCBI-GeneID: 939901
NCBI-ProteinID: NP_388424
Pasteur: BG12157
BSORF: BG12157
UniProt: P96687 A0A6M3Z7Y1
Position
589717..591891
AA seq 724 aa
MSKMLYTLGGWVARNRIKAICAWIVVLVAAIGLAVTLKPSFSEDMSIPDTPSEKAMDVIQ
KEFPHGPDKGSIRVIFGAGDGEKLTGKPAKKAIEDTFKEISKDDSVDSIASPFVTGTIAK
DGTVAYADIQYKSSADDIKDYSIKHLKDSLKMADDEGLQTELSGDVPGAEMEIGGVSEIV
GIILAFVVLAITFGSLLIAGLPILTALIGLGVSIGLVLIGTQVFDIASVSLSLAGMIGLA
VGIDYALFIFTKHRQFLGEGIQKNESIARAVGTAGSAVVFAGLTVIVALCGLTVVNIPFM
SAMGLTAGLSVLMAVLASITLVPAVLSIAGKRMIPKSNKKIEKQSTETNVWGRFVTKNPI
MLSVCSILILIVISIPSMHLELGLPDAGMKAKDNPDRRAYDLLAEGFGEGFNGQLTIVAD
ATNATENKAEAFADAVKEIKGLDHVASVTPAMPNKEGNFAIITVVPETGPNDVTTKDLVH
DVRSLSDKNGVDLLVTGSTAVNIDISDRLNDAIPVFAVLIVGFAFVLLTIVFRSLLVPLV
AVAGFMLTMTATLGICVFVLQDGNLIDFFKIPEKGPILAFLPILSIGILFGLAMDYQVFL
VSRMREEYVKTNNPVQAIQAGLKHSGPVVTAAGLIMIFVFAGFIFAGEASIKANGLALSF
GVLFDAFIVRMTLIPSVMKLMGNAAWYLPKWLDKIIPNVDIEGHQLTKEIQPEIDHEQKK
QISV
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgtcaaaaatgttatatacattaggaggatgggttgctcgcaatcgcataaaagcaata
tgtgcgtggatcgttgtgttagttgctgcgataggccttgcagtgaccttgaaaccaagt
ttttctgaggatatgtccatacctgacacaccttcggaaaaagcgatggatgtgattcaa
aaagaatttcctcatggtcctgataaagggagcatacgggttattttcggtgctggtgat
ggggagaaacttactgggaagccagcaaaaaaagcaatagaagatacgttcaaagaaatc
agtaaagatgattctgttgactcgattgcaagtccttttgtgacagggacaatcgcgaaa
gatggcacagttgcctatgctgatatccagtataaatcatcagcagatgatataaaggat
tactctatcaaacacttaaaagacagtttgaaaatggctgatgatgaaggattgcaaact
gagctaagcggagatgtaccgggagcggagatggagataggcggtgtctctgaaattgtc
ggcattatcttggcttttgtcgttttagccattacattcggttctttattaatagcaggt
ttgccgattttaactgcactgattggtttaggtgtaagtattggactggttttgattggg
acacaagtatttgatattgcttctgtcagtctttcattagccggaatgattggccttgct
gttggtattgattatgctttatttatttttacgaaacaccgccagtttttaggcgaaggc
atacaaaagaatgaatcaattgcgagagccgtgggaacagcgggaagtgcagtggttttt
gccggacttactgttatcgttgcactttgcggattaactgtcgttaacattccttttatg
tctgcgatggggctgacagcagggcttagtgtactgatggctgttttggcttccatcaca
cttgtgcctgcggtcttatcgattgcagggaagcggatgattccgaaatcaaacaagaaa
atagaaaaacaaagcactgaaacaaatgtctggggacgctttgtcaccaaaaatcctatc
atgctaagtgtatgcagcattctgattttgatcgtcattagtatcccatctatgcatttg
gaactgggcttgcctgatgctgggatgaaagctaaggataatccggatcgccgggcatat
gacttgcttgccgaaggctttggagaaggatttaatggccaattaacaatcgtagcggat
gccacaaatgctacagaaaataaggcggaggctttcgcagatgcagtgaaagaaataaag
ggcttagaccatgtagcaagtgtcactcctgcaatgcctaataaagaagggaactttgcc
atcattacggtcgttcctgaaacaggtccaaatgatgtcacaacgaaagatttggtacat
gatgtacgcagtttatcagataaaaacggagtagatttgcttgttactggatcaactgca
gtgaatattgacatttcagatcgcctgaatgatgcgataccggtgtttgctgtacttatt
gttggctttgcgtttgtattgctgaccatcgttttccgttcgctgcttgtgccgcttgtt
gctgttgcaggtttcatgttgacgatgacagccactcttggaatctgtgtatttgtcttg
caagacgggaatctcatcgactttttcaaaatacctgaaaaagggccgatactcgcgttc
ctgccgattttatcgattgggattctgttcgggttagccatggattatcaagtattcctt
gtcagcagaatgcgtgaagaatatgtaaaaacaaacaatccagtacaagccattcaggct
ggattaaaacacagtggtcctgttgttacagcagccggcttgatcatgatcttcgttttt
gcaggatttatctttgcaggcgaagcttctattaaagccaatgggctggctctttccttt
ggtgtactctttgatgcctttattgtaagaatgacactgattccaagtgtcatgaagctg
atggggaatgcagcctggtatttgccgaaatggttagacaagattattccgaatgtggat
atagaagggcatcaactgacaaaggaaatacagccggaaatagatcatgaacaaaagaaa
caaatcagtgtgtaa

DBGET integrated database retrieval system