KEGG   Bacillus subtilis subsp. subtilis 168: BSU05440
Entry
BSU05440          CDS       T00010                                 

Symbol
nap
Name
(RefSeq) carboxylesterase nap
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase
Other DBs
NCBI-GeneID: 938069
NCBI-ProteinID: NP_388425
Pasteur: BG11957
BSORF: BG11957
UniProt: P96688 A0A6M3Z7T5
Structure
Position
complement(592303..593205)
AA seq 300 aa
MSNHSSSIPELSDNGIRYYQTYNESLSLWPVRCKSFYISTRFGQTHVIASGPEDAPPLVL
LHGALFSSTMWYPNIADWSSKYRTYAVDIIGDKNKSIPENVSGTRTDYANWLLDVFDNLG
IEKSHMIGLSLGGLHTMNFLLRMPERVKSAAILSPAETFLPFHHDFYKYALGLTASNGVE
TFLNWMMNDQNVLHPIFVKQFKAGVMWQDGSRNPNPNADGFPYVFTDEELRSARVPILLL
LGEHEVIYDPHSALHRASSFVPDIEAEVIKNAGHVLSMEQPTYVNERVMRFFNAETGISR
NT seq 903 nt   +upstreamnt  +downstreamnt
atgtcaaaccattcatctagtattcccgaattaagtgacaacggtatccgctattatcaa
acttataatgaaagccttagtctttggccggtccgttgtaaatcattctatatatctact
cgttttggtcaaacacatgtgattgcaagcggcccagaggatgccccgccgcttgtatta
ctccacggagcattattcagctcgacgatgtggtatcccaacatcgccgattggagcagt
aaatacagaacttatgcagttgatatcataggtgataaaaacaagagtattcctgagaat
gtaagcggtacaagaacggattacgccaattggcttcttgatgtgtttgacaatctgggg
atcgaaaagtcccacatgatcggactttcgcttggcggtctccatacgatgaatttcctt
ttacgtatgcctgagagagtaaaaagcgcagctatactgagtccggcagaaacgtttttg
ccatttcatcacgatttctacaaatacgctcttggccttacagcgtcaaatggagttgaa
acattcttaaattggatgatgaatgatcagaatgtgctgcacccgatttttgtgaagcag
tttaaggcaggggtaatgtggcaggatggatcaagaaatccaaatcctaatgccgacgga
tttccgtatgtttttaccgatgaggaattacgttcagcaagagttcctatcctattatta
cttggtgaacatgaagtcatctatgatccccactcagccctgcaccgagcctcttcattc
gttccagatattgaggcggaagtcattaaaaatgccggacatgttttatcgatggaacaa
cccacttacgtaaatgaacgtgtaatgcgttttttcaatgcagaaacaggcatttcacgg
taa

DBGET integrated database retrieval system