KEGG   Bacillus subtilis subsp. subtilis 168: BSU05450
Entry
BSU05450          CDS       T00010                                 

Symbol
ydfK
Name
(RefSeq) hypothetical protein
  KO
K07150  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU05450 (ydfK)
SSDB
Motif
Pfam: DUF554 CD34_antigen
Other DBs
NCBI-GeneID: 939896
NCBI-ProteinID: NP_388426
Pasteur: BG12158
BSORF: BG12158
UniProt: P96689 A0A6M3ZB34
Position
complement(593407..594096)
AA seq 229 aa
MFGTIFNTVMIIAGSIIGGIFKKGIKDEYQDILMQAMGFAAVALGINAITQHLPDSKYPI
LFIVSLAIGGLLGQIINLELRFNKLVNKFSKSNLAEGLSTAVLLFCIGSLSILGPVEAAL
HGDYTYLLTNGMLDGITSIVLASTFGFGIAAAALVLFSWQGSIYLFAQVMESAINTDLIN
EITIVGGILILSSGLSILGIKKFKTLNLLPSLLIPPVVIFVIHAFGLRF
NT seq 690 nt   +upstreamnt  +downstreamnt
atgtttggaacgatttttaacacagtgatgatcattgcaggaagcataatcggggggata
ttcaaaaaaggcattaaagatgaataccaggatattttgatgcaggcaatgggattcgct
gcggtcgcactggggatcaacgccattacacagcatttgcctgatagtaaataccccatt
ctattcatcgtgagtttagccattggaggtttgctaggccagatcatcaatttagaatta
cgattcaacaagctggtgaacaaattttctaaaagcaatttagcagagggcttatcaact
gcggtcttattattttgtataggttcgctgtcaatattaggccctgttgaagccgctttg
catggagattatacataccttctgacaaacgggatgttagatgggatcacctccattgtg
ctcgcttcaacttttggttttggaatagcggctgccgcacttgtattattttcctggcag
ggctccatctatttatttgcacaagtaatggagagcgcaatcaatacagaccttattaat
gaaatcacaattgtgggaggcatactcatcctcagttcaggtctaagcattcttggaatc
aagaagttcaaaacactgaatctgctgccttccctcctgatccctcctgttgtgattttt
gtgattcatgcatttggattgcggttttaa

DBGET integrated database retrieval system