KEGG   Bacillus subtilis subsp. subtilis 168: BSU05470
Entry
BSU05470          CDS       T00010                                 

Symbol
ydfM
Name
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Cation_efflux ZT_dimer
Other DBs
NCBI-GeneID: 939900
NCBI-ProteinID: NP_388428
Pasteur: BG12160
BSORF: BG12160
UniProt: C0SP78 A0A6M4JDF7
Position
complement(595109..596002)
AA seq 297 aa
MASEREQISRKVALIALIANLILMAGKVFFGLVGDSEAVFADGIHSAADVVASIAVLAVI
GISNKPPDQDHPFGHGKAEVISEAIVGIILVIVSVYILIEAILSFVKGPSVPQYSALFAA
LISYVAKEILYRYSIKQGKKWNSKAIIAIAYDHKGDIVASLAAFIGVLLAIIGNSRGWSY
LLYADAIASAIVAYLIFKISMELIRPSVDVLMEKSVDPELIEEYKAVIFQCDQVKRIDRI
RAREHGHYKLLDVRLSLDHDLTIKQGHDIAREIRNEIKRQFSDVEEVLIHVNPYFEE
NT seq 894 nt   +upstreamnt  +downstreamnt
atggcaagtgaaagagaacaaataagcagaaaagttgctttgattgcattgatcgccaat
ctgatcttaatggcaggaaaggtcttttttgggctggtaggcgatagtgaagccgtgttt
gcagacggaatacattccgcggcagatgtcgttgcttcgattgcagtcttggcagtgatc
ggaatttccaataaaccgcccgatcaagaccatccttttggtcacggaaaagctgaagtc
attagtgaggcgattgtaggaattatcttagtgatcgtatccgtttatatcctcatagaa
gcgattctgtcctttgttaaagggccaagcgttccccaatacagcgcattgtttgcggct
ctgatttcgtacgtggctaaggaaatcttatatcgttattctataaagcaagggaaaaaa
tggaacagcaaagcgattatagcgattgcgtacgatcataaaggcgatatcgttgcctct
cttgccgcttttatcggcgtcctgttggctatcatcggaaacagccgtggatggtcctat
ctgttgtacgccgatgccattgccagtgcaatcgttgcttacctcatttttaagatttca
atggaattaatcaggccgtctgttgatgtgctcatggaaaagagtgttgatcccgagctg
atagaggaatataaagctgttatttttcaatgtgatcaggtaaaacgaattgatagaatc
cgcgcgcgagaacatggccactataaattgcttgatgtccgtttatctttggatcatgat
ttgacaattaagcagggacacgacattgcccgcgaaattcgaaatgaaatcaaaagacag
ttttcagatgtagaagaagtgctcatccatgtaaatccttatttcgaagaatga

DBGET integrated database retrieval system