KEGG   Bacillus subtilis subsp. subtilis 168: BSU05480
Entry
BSU05480          CDS       T00010                                 

Symbol
ydfN
Name
(RefSeq) NAD(P)H nitroreductase MhqN
  KO
K15976  putative NAD(P)H nitroreductase [EC:1.-.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU05480 (ydfN)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     BSU05480 (ydfN)
SSDB
Motif
Pfam: Nitroreductase TM1586_NiRdase CytoC_RC
Other DBs
NCBI-GeneID: 939899
NCBI-ProteinID: NP_388429
Pasteur: BG12161
BSORF: BG12161
UniProt: P96692 A0A6M4JFD7
Structure
Position
596478..597098
AA seq 206 aa
MAEFTHLVNERRSASNFLSGHPITKEDLNEMFELVALAPSAFNLQHTKYVTVLDQDVKEK
LKQAANGQYKVVSSSAVLLVLGDKQAYQQAADIYEGLKVLGILNKQEYDHMVQDTVSFYE
NRGEQFKRDEAIRNASLSAMMFMLSAKEKGWDTCPMIGFDAEAVKRILNIDDQFEVVMMI
TIGKEKTESRRPRGYRKPVNEFVEYM
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctgaatttactcatttagtcaatgaaagacgatctgcaagcaattttctttcaggt
catccaatcacaaaagaagatctcaatgagatgtttgaattggttgcattggcaccatcg
gcttttaatttgcagcatacaaaatatgtgacggttcttgaccaggacgtaaaggaaaag
ctgaagcaggccgcaaacggacaatataaagtggttagctcttctgcggttctcttggta
ttaggggataagcaggcatatcaacaagcggccgatatctatgaaggtttaaaggtattg
gggatattaaataagcaagagtatgaccacatggtgcaagacaccgtttcgttttatgaa
aacaggggagaacaatttaagagagatgaggcgataaggaatgcttcactttctgcgatg
atgtttatgctgagtgctaaggaaaaaggctgggatacctgcccgatgatcggctttgat
gcggaagccgtaaaacggattttgaacatagacgaccaatttgaggttgtcatgatgatt
acgattggaaaagaaaaaacagagagcagaagaccgcgcggctaccggaagcctgtgaat
gagtttgttgagtatatgtaa

DBGET integrated database retrieval system