KEGG   Bacillus subtilis subsp. subtilis 168: BSU05490
Entry
BSU05490          CDS       T00010                                 

Symbol
ydfO
Name
(RefSeq) ring-cleaving dioxygenase MhqO
  KO
K15975  glyoxalase family protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99999 Others
    BSU05490 (ydfO)
SSDB
Motif
Pfam: Glyoxalase
Other DBs
NCBI-GeneID: 939894
NCBI-ProteinID: NP_388430
Pasteur: BG12162
BSORF: BG12162
UniProt: P96693 A0A6M4JFW9
Structure
PDB: 
3OAJ

Position
597114..598052
AA seq 312 aa
MAKKTMGIHHITAIVGHPQENTDFYAGVLGLRLVKQTVNFDDPGTYHLYFGNEGGKPGTI
ITFFPWAGARQGVIGDGQVGVTSYVVPKGAMAFWEKRLEKFNVPYTKIERFGEQYVEFDD
PHGLHLEIVEREEGEANTWTFGEVTPDVAIKGFGGATLLSEQPDKTADLLENIMGLERVG
KEGDFVRYRSAGDIGNVIDLKLTPIGRGQMGAGTVHHIAWRANDDEDQLDWQRYIASHGY
GVTPVRDRNYFNAIYFREHGEILFEIATDPPGFAHDETQETMGEKLMLPVQYEPHRTQIE
QGLLPFEVRELD
NT seq 939 nt   +upstreamnt  +downstreamnt
atggctaaaaaaacgatgggaattcatcatattacagcgattgtcggtcaccctcaagag
aacacagatttttacgcaggagtgcttgggcttcgtttggtcaagcaaactgtcaatttt
gatgacccaggtacgtatcatctttattttgggaatgaaggcgggaagccgggaacaatc
attaccttctttccgtgggccggagcccgccaaggcgtcattggagacggtcaagttggc
gtgacttcgtatgtcgtgccgaaaggggctatggcattttgggaaaagagactagaaaag
ttcaacgttccctacaccaaaatcgagcgctttggggaacaatatgtagaatttgatgat
cctcatggactgcacttagaaatcgtggaaagagaagaaggagaggctaatacgtggact
ttcggagaagtaacgcccgatgttgccattaaaggttttgggggtgcaaccctattatca
gagcagcctgacaaaaccgctgaccttttagaaaacatcatggggctggagcgagtcggc
aaagaaggagacttcgttcgttatcgttccgccggtgatatcggaaatgtgattgacctt
aagttaacgcctattggccgcgggcaaatgggggccggaacggtgcatcacatcgcttgg
cgggctaacgatgatgaagatcagttagattggcaaagatatattgcttcccacggatat
ggtgtaactcctgttcgggatagaaactactttaatgccatttacttcagggaacacggg
gaaatcctgtttgaaatcgcaactgatcccccaggctttgcacatgatgaaacacaggaa
acaatgggcgaaaaactgatgctgcctgtgcaatatgaaccgcatcgcacacaaattgaa
caagggctgctgccgtttgaagtaagagagttagattga

DBGET integrated database retrieval system