KEGG   Bacillus subtilis subsp. subtilis 168: BSU05500Help
Entry
BSU05500          CDS       T00010                                 

Gene name
ydfP
Definition
(RefSeq) oxidoreductase
  KO
K15977  putative oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99999 Others
    BSU05500 (ydfP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DoxX DoxX_2
Motif
Other DBs
NCBI-GeneID: 938077
NCBI-ProteinID: NP_388431
Pasteur: BG12163
BSORF: BG12163
UniProt: P96694
Position
598154..598543
Genome map
AA seq 129 aa AA seqDB search
MEDAGLLLIRIMIGVVFLFYGTQKLFGWFGGYGIKGTGQWFESIGVKPGNVAAALSGLGE
LVSGILFILGVFLPLGAAIITIIMLGAIVKVHGAKGFANGAGGFEYNLVLIAVSIGVALI
GSGAYALHF
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgcaggactgttgcttattcgtataatgattggtgtggtgtttttgttttat
ggcacacaaaaattattcggctggtttggcggatacgggattaaaggaaccggacaatgg
ttcgaatcaattggggtgaaaccaggaaacgttgcggccgctctatcaggtcttggggag
ttagtaagcggaattctatttattttaggcgtattcctcccgcttggagctgctatcata
acaatcatcatgttaggtgctatcgtaaaagtccatggagcgaaaggttttgcgaatggc
gccggaggttttgaatataacctggtgctcattgcagtttccataggggttgcactcatc
ggttcaggagcttacgctttgcatttttaa

DBGET integrated database retrieval system