KEGG   Bacillus subtilis subsp. subtilis 168: BSU05520
Entry
BSU05520          CDS       T00010                                 

Symbol
ydzH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: gerPA Nbas_N
Other DBs
NCBI-GeneID: 938074
NCBI-ProteinID: NP_388433
Pasteur: BG12810
BSORF: BG12810
UniProt: O31496 A0A6M4JGT5
Position
complement(599107..599343)
AA seq 78 aa
MRSQINISNLTINGMTQNANTDIGQNLQNSHTANSKNYGVNFTLGDYSPSHSIIISASCD
NDTSDQGQVDNPSSPSEE
NT seq 237 nt   +upstreamnt  +downstreamnt
atgcgatctcaaatcaacatctcaaatctcacgataaatggaatgacacaaaacgccaat
acagatatcggacaaaacttgcaaaacagccatactgcgaacagcaaaaattacggagtg
aatttcacattaggagattactctccttctcattcaattattatttcagcaagttgtgat
aatgatacaagtgatcaagggcaggttgataacccttcttcgcctagtgaagaataa

DBGET integrated database retrieval system