KEGG   Bacillus subtilis subsp. subtilis 168: BSU05530
Entry
BSU05530          CDS       T00010                                 

Symbol
ydfR
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF421 FlgH
Other DBs
NCBI-GeneID: 939897
NCBI-ProteinID: NP_388434
Pasteur: BG12165
BSORF: BG12165
UniProt: P96696
Position
complement(600229..600906)
AA seq 225 aa
MNRLPFGYIKLRLAGRKANPMTNLIHHWSGGSMNFTWESLVLIVAGVILLRISGRKSIAQ
MTSTQTVVMISIGTIIVQPIIEYSLFKTLIAAAIFTSTLIVMEWIQMKSNTIEKMLTGKA
KIVIENGQLHIENLKKMRLTADQLEMQLRLHGVTAIQDVKIATLEANGQLGIELTDDAKP
LTVRDLKKLIHPDFINKDGQAQSGNQNIFDEVGKKNKKNVPKKLH
NT seq 678 nt   +upstreamnt  +downstreamnt
atgaaccgactgcctttcggatatattaaattgcgattggccggaagaaaagccaatccc
atgacaaatctaattcatcattggtcaggtggtagcatgaatttcacttgggaatctctt
gttctcattgtagccggggtcattttgctgagaatttcaggaaggaaatcaatcgcacaa
atgacgtcgactcaaacggttgtcatgatttcgatcggaactattatcgttcagccaatc
atcgagtacagcctcttcaaaacattaattgcagcggcaattttcacaagcacactcatc
gttatggaatggatccaaatgaaatcgaacaccattgaaaagatgttaaccggaaaagca
aaaatcgtcattgaaaacggacagcttcatatcgaaaacttaaagaagatgagacttaca
gctgaccagcttgaaatgcagctaaggcttcacggcgttacggctatacaagatgtcaaa
attgcgacattagaggcaaacgggcaattaggaatagaattaactgatgacgccaagcct
ttaacagtcagggatctgaaaaaactcattcaccccgatttcataaataaggacggacaa
gcccagtctggcaatcagaatatttttgatgaagttggcaaaaaaaataaaaaaaacgtc
cctaaaaagctgcattaa

DBGET integrated database retrieval system