KEGG   Bacillus subtilis subsp. subtilis 168: BSU05540
Entry
BSU05540          CDS       T00010                                 

Symbol
ydfS
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF421
Other DBs
NCBI-GeneID: 939890
NCBI-ProteinID: NP_388435
Pasteur: BG12166
BSORF: BG12166
UniProt: P96697 A0A6M3Z869
Position
601019..601726
AA seq 235 aa
MIELEVVIRTVASFGLLLIAERILGKQTISQMTIFDFIAAITLGAIAAGLAYNTSIKPHN
MAISFSIFVLTIFLISFLSIKNRKLRKFFAGDPTVLIQNGKILESNMRKMRYTLDYLNQQ
LREKEIFNIEEVLFAILETNGQLTVLRKPQFRHVTKQDLMIAVNQEQRLPIELIMDGEII
ENNLKQNRLTESWLLEELRKRDIKVKETVYAVLLGNGDIYVDQYKDHISVPMDKE
NT seq 708 nt   +upstreamnt  +downstreamnt
atgattgaacttgaagttgtcattagaacggttgccagctttggcttgctgttaatcgca
gaacgaattttaggcaaacagacaatctctcaaatgacgatttttgattttattgcggcg
atcacactaggggcgattgctgccggattagcttacaatacttcaataaaaccgcacaat
atggccatttcgtttagtatttttgtgctaaccatttttctaatttcgtttctgtcgata
aagaacaggaagctgaggaaattttttgccggagatccaacagtgctgattcaaaacggg
aagatacttgaatcaaatatgaggaaaatgcgttacacacttgattatttaaatcagcaa
ttacgggaaaaagaaatatttaatatcgaagaagttctttttgccattcttgaaacgaat
ggtcagctgactgtgttaagaaaaccgcaattccggcatgtgaccaaacaggatttaatg
attgcggtaaaccaagaacaaaggcttccgatagaacttattatggacggagaaatcatt
gagaataatttaaagcagaatcgtttgacggaatcctggcttttggaagaattgcgaaaa
agagacataaaggtgaaagagaccgtgtacgcagtgctgctgggtaatggggatatttat
gtggatcaatataaagaccatatatcagtccctatggataaggaatga

DBGET integrated database retrieval system