KEGG   Bacillus subtilis subsp. subtilis 168: BSU05550
Entry
BSU05550          CDS       T00010                                 

Symbol
cotP
Name
(RefSeq) spore coat protein P
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HSP20
Other DBs
NCBI-GeneID: 938073
NCBI-ProteinID: NP_388436
Pasteur: BG12167
BSORF: BG12167
UniProt: P96698 A0A6M3ZD51
Position
complement(601741..602172)
AA seq 143 aa
MDFEKIRKWLEITNEYKQSDFWTNVLKYKAPEHFFDSEASTFVYDFYQDEEYNFIIVEMP
GVYEEELTIRLLSKTQLLIKGTITPVFPAEMEVLRERYYGEIERIIQLPEAAETHLLQIQ
LLNGLLHISYPRQVETVAFNKGL
NT seq 432 nt   +upstreamnt  +downstreamnt
atggatttcgaaaaaattcgaaagtggcttgagattacgaatgaatataaacaaagtgac
ttttggacaaatgtgctcaaatataaagccccggaacatttttttgattccgaagcttct
acgtttgtttacgacttttatcaagatgaggaatataattttatcattgtggaaatgccc
ggtgtgtatgaggaagaattaacgatccgtttactgtctaaaacccagctgctgatcaaa
ggaacgatcacgcctgtttttccagccgaaatggaagtgctgcgtgaacggtattacgga
gaaattgagcgaatcattcagcttcccgaagccgctgaaactcatttgttacagattcag
ctgttaaacgggcttctgcatatttcgtacccaagacaagttgaaaccgttgcgttcaat
aaggggctttaa

DBGET integrated database retrieval system