KEGG   Bacillus subtilis subsp. subtilis 168: BSU05560
Entry
BSU05560          CDS       T00010                                 

Symbol
ydgA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: gerPA
Other DBs
NCBI-GeneID: 938065
NCBI-ProteinID: NP_388437
Pasteur: BG12168
BSORF: BG12168
UniProt: P96699 A0A6M4JFE4
Position
complement(602185..602427)
AA seq 80 aa
MPYQINIANIKINGVTQNGNIDVGPTVHNSHTANSKYFGANFSLGDLSPTSSLLNTGNID
SDVSDQDQIGNPSAPISNQI
NT seq 243 nt   +upstreamnt  +downstreamnt
atgccatatcaaattaatatcgcaaatattaagatcaacggcgtcacgcaaaacggaaat
atagatgtcggtccgactgtgcacaacagccatactgcgaacagcaaatattttggagca
aacttttccttaggggatctttcgcctacgtcttcacttttaaacactggaaatattgat
tcagacgttagtgaccaagaccaaatcggaaacccttctgcgccgatttcaaatcaaatt
taa

DBGET integrated database retrieval system