KEGG   Bacillus subtilis subsp. subtilis 168: BSU05570
Entry
BSU05570          CDS       T00010                                 

Symbol
ydgB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: gerPA
Other DBs
NCBI-GeneID: 938056
NCBI-ProteinID: NP_388438
Pasteur: BG12169
BSORF: BG12169
UniProt: P96700 A0A6M4JFX8
Position
complement(602441..602713)
AA seq 90 aa
MPSTVINLYYLKINSISGNGSITIGEAAYNSPTNNQKSQGTNSSFGDTSPTESVMENFLN
DPDVNDQTSIGNSDTSNVNAPPIAPPPILD
NT seq 273 nt   +upstreamnt  +downstreamnt
atgccgtctacagtaatcaacctatattatttgaagatcaacagtatttcgggcaatggt
tcaattacaataggcgaagctgcttataacagccctaccaacaatcaaaaatctcaaggg
accaactcttctttcggtgatacatcacctacagaatccgtaatggaaaacttcttaaac
gatcctgatgtaaatgaccagacatctatcggcaactctgatacatccaacgttaatgct
cctccgattgcaccaccgccaattttagattaa

DBGET integrated database retrieval system