KEGG   Bacillus subtilis subsp. subtilis 168: BSU05580
Entry
BSU05580          CDS       T00010                                 

Symbol
ydgC
Name
(RefSeq) TetR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TetR_N TetR_C_4 TetR_C_26 TetR_C_36 TetR_C_24 TetR_C_15
Other DBs
NCBI-GeneID: 938064
NCBI-ProteinID: NP_388439
Pasteur: BG12170
BSORF: BG12170
UniProt: P96701 A0A6M4JFT4
Position
603012..603599
AA seq 195 aa
MKSKGVESRKRLLKAAANEFSVRGFHDAKVSEIVKKAGFTQPSFYLYFQSKEAIFAELIT
DFHSRVRKLTESLLLENGLNTEDVSKRVLLAVETVFQFLDEDKDLTKIGFFLNPEAKQMK
KDLAMVLKENLEAEQRLGYFHSELDMETVAECLVGMIEHLTESFLLTGIKDPASLAAEVV
NLLIYGMLPKGNDVR
NT seq 588 nt   +upstreamnt  +downstreamnt
ttgaaaagtaaaggagtagaaagccgaaaacgattacttaaagctgccgctaatgaattt
tcggttcggggattccatgacgcgaaggtaagtgaaattgtgaaaaaagctgggttcacg
cagccttcattttacctgtactttcaaagcaaagaagccatctttgccgagttaataacc
gattttcactctcgagtcagaaagctgacagagtcacttcttctggaaaacggattaaac
acggaggatgtgtcaaaacgggtactgctagctgtagagactgtttttcaatttttggat
gaggacaaggatttaaccaagatcggcttttttctcaacccggaagcaaaacaaatgaaa
aaagacttggcgatggttttgaaagagaacttagaagcagaacagcggcttggctatttt
cactctgaactggatatggaaactgtcgctgagtgtttggtcggcatgattgaacattta
accgaatcatttttgttaaccggaatcaaagatccggcaagcctcgcagcagaggttgtg
aatcttttaatttacgggatgcttccgaaagggaatgatgtaagatga

DBGET integrated database retrieval system