KEGG   Bacillus subtilis subsp. subtilis 168: BSU05590
Entry
BSU05590          CDS       T00010                                 

Symbol
ydgD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DoxX_2 DoxX AMO FUSC-like
Other DBs
NCBI-GeneID: 939895
NCBI-ProteinID: NP_388440
Pasteur: BG12171
BSORF: BG12171
UniProt: P96702 A0A6M3Z7T8
Position
603596..603940
AA seq 114 aa
MISIMMKVSLAVFMLAGGIIKVSRVPFQVEHWRHYQYPLWFLTVTGILEIAGALAMTAGI
WNRYAAIGAGVLFVVLMAGAIHAHMFRARQSVIMAIQAMICLIVSIMIIMGSYT
NT seq 345 nt   +upstreamnt  +downstreamnt
atgatatctattatgatgaaagtcagtttggcagtttttatgcttgcgggaggcatcata
aaggtaagccgcgttccctttcaagttgagcattggcggcattatcaatatccattatgg
tttctgactgttactggcattcttgaaatagccggggcacttgctatgacagcgggaatt
tggaatcggtatgcagcaattggagcaggtgttctgtttgtcgttctcatggcgggagca
attcatgcgcatatgtttcgagcaagacaatctgtcatcatggcgatacaagcgatgatt
tgtttgattgtttcaatcatgatcatcatggggagttacacgtaa

DBGET integrated database retrieval system