KEGG   Bacillus subtilis subsp. subtilis 168: BSU05600
Entry
BSU05600          CDS       T00010                                 

Symbol
ydgE
Name
(RefSeq) N-acetyltransferase YdgE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_3 FR47 Acetyltransf_10 Acetyltransf_4 Acetyltransf_7 GNAT_acetyltran
Other DBs
NCBI-GeneID: 939907
NCBI-ProteinID: NP_388441
Pasteur: BG12172
BSORF: BG12172
UniProt: P96703 A0A6M3Z7Z7
Position
604103..604576
AA seq 157 aa
MAFTLEDMTEEEFEAFRGMSVQNFAKQNITSGTWTEKEAFEKSEQAYENMIPNGRDSSNH
YFWNITNDQGERMGWLWLYADPLHPQKEAFIYSFGLYEAFRGKGLAQLALQTLDERAREL
GAERLALHVFAHNETAVYLYQKMGYAMTNIRMRKQLC
NT seq 474 nt   +upstreamnt  +downstreamnt
atggcattcactttggaagacatgactgaggaagagttcgaagcctttcgcgggatgtcc
gtgcaaaattttgcgaaacaaaacataacgtcaggaacttggacggaaaaagaggcattt
gagaaatcggagcaggcatatgagaacatgattccgaatgggcgagacagcagcaatcat
tatttttggaacatcacaaatgaccaaggagaaagaatgggctggctctggctgtatgct
gatccattacatccgcaaaaggaagcgtttatctattcctttggattgtatgaagccttt
cgcggaaaaggacttgctcaattggcgcttcaaacgcttgatgaaagagcaagagagctt
ggtgcggaaaggctggctctacatgtatttgcacacaacgagacagccgtctatctttat
cagaagatgggctatgccatgaccaatatacgtatgcggaaacagctatgctga

DBGET integrated database retrieval system