KEGG   Bacillus subtilis subsp. subtilis 168: BSU05620
Entry
BSU05620          CDS       T00010                                 

Symbol
ydgF
Name
(RefSeq) transporter
  KO
K11737  D-serine/D-alanine/glycine transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU05620 (ydgF)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU05620 (ydgF)
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-GeneID: 938050
NCBI-ProteinID: NP_388443
Pasteur: BG12173
BSORF: BG12173
UniProt: P96704 A0A6M3Z7V3
Position
complement(606699..608075)
AA seq 458 aa
MTDDMTKDNINQQTLQRGLKNRHIQLIAIGGAIGTGLFLGSGKSIHFAGPSILFAYMITG
IICFLIMRSLGELLLSNLNYHSFVDFVQDYLGDMAAFITGWTYWFCWISIAMADLTAVGL
YTQYWLPGVPQWVPGLIALIILLIMNLATVKLFGELEFWFALIKVIAILALIVIGLVMIF
KGFSTSSGVSSFTNLWSHGGLFPNGMHGFILSFQMVVFAFVGIELVGLTAGETENPEKVI
PKAINNIPVRVLLFYIGALLVIMSIYPWDIINPSESPFVQVFVAVGIVGAASIINFVVLT
SAASACNSAVFSTSRMVYSLAKDHNAPESMAKLTQRKVPRNALFFSAIVILIGVTLNYIM
PEGVFTLITSISTVCFIYIWGITVICHMKYRKTRPELAKTNKFKLPLYPFTNYLILAFLA
FVLVVLALAQDTRVSLFVTPVWFILLIVIYKVRKAKHQ
NT seq 1377 nt   +upstreamnt  +downstreamnt
gtgacagacgacatgacgaaagacaatataaatcagcaaacgttgcagagaggcttgaaa
aacaggcatatccagctcatcgccatcggcggagccattgggacaggcttatttctcggc
tcgggcaaatcgattcattttgccggaccttcgattttatttgcttatatgatcacaggg
atcatttgctttttaattatgagatcgctgggtgaactgctgttatcaaacttgaactat
cactcttttgtggattttgtacaagactacctaggcgatatggcagcttttatcaccggc
tggacatattggttctgctggatttccattgcgatggctgatctgacagcagtcgggctc
tacactcaatattggctcccgggtgtgccgcaatgggtgcctggcttaatcgctcttatt
attttactgattatgaatctggcgacagtcaagctttttggagaattagaattttggttc
gctttgattaaagtcattgccattttggcgttaatcgtcattggccttgtgatgattttc
aaaggcttttccacaagctcaggagtgtccagcttcacaaacctctggagccacggaggc
ctgttcccgaatggcatgcacgggtttatcctctcgttccagatggttgtgtttgctttt
gtcggcattgagcttgtcgggcttacggccggtgaaacagaaaaccctgaaaaagtaatc
cctaaggcgatcaacaatattcctgtccgtgtgctgcttttttatatcggggctcttctc
gtgattatgagcatctatccttgggatatcatcaatcccagcgaaagcccattcgtacaa
gtatttgtcgctgttggcatcgtcggggctgcaagtattatcaactttgttgtgttgaca
tccgctgcttcagcatgcaacagcgctgtattcagtacaagccgtatggtctattccctg
gcgaaagatcacaatgcgcctgagtcaatggcgaaactgactcagcgtaaagtgcctaga
aatgctttattcttttcagctatcgtgattttaatcggtgttacgttaaactacatcatg
ccagaaggcgtattcaccctgatcacaagtatttcaaccgtatgctttatctacatttgg
gggattacggtcatctgccatatgaaataccgcaaaacaagacctgaattagcgaaaaca
aacaagtttaagcttccgctttatccgtttacaaattacctgattcttgcgttcctggcg
tttgttctggttgtgctggcactggcacaggatactcgtgtttccttatttgtcacaccg
gtttggtttattttgctgattgtgatttataaagtgagaaaagcgaagcatcaataa

DBGET integrated database retrieval system