KEGG   Bacillus subtilis subsp. subtilis 168: BSU05630
Entry
BSU05630          CDS       T00010                                 

Symbol
dinB
Name
(RefSeq) protein DinB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DinB DinB_2 PI3K_P85_iSH2
Other DBs
NCBI-GeneID: 938057
NCBI-ProteinID: NP_388444
Pasteur: BG10539
BSORF: BG10539
UniProt: Q02886 A0A6M3ZB47
Position
complement(608246..608764)
AA seq 172 aa
MSDFAFKLYEYNVWANQQIFNRLKELPKEIYHQEIQSVFPSISHVLSHVYLSDLGWIEVF
SGKTLSDALALAEQLKEQTEAKEIEEMEDLFLRLSERYILFLQQKEQLNKPLQIQNPSSG
IMKTTVSELLPHVVNHGTYHRGNITAMLRQAGYASAPTDYGLYLFMTKTEKA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtcagattttgcattcaaattgtatgaatataacgtctgggccaatcaacaaatattc
aaccgattaaaagagcttccaaaagagatataccatcaagaaattcaaagcgtgtttccg
tcaatatcccatgtattgtctcatgtttatctttctgatctcggctggattgaagtgttt
tccggcaaaaccttgagcgatgcgttggctttagctgaacagcttaaagaacagacagag
gctaaagaaatagaggaaatggaagacctttttctgaggttatccgagcgctatatacta
tttttacagcaaaaagaacagctcaataagccactccagattcaaaatccctcaagcgga
atcatgaaaacaactgtttccgaactgcttccccacgttgtcaatcacgggacataccac
cgcggcaatatcacagcaatgctgcggcaggcaggctacgcatccgcaccgacagattac
gggctctacctgtttatgacaaaaactgaaaaagcataa

DBGET integrated database retrieval system