KEGG   Bacillus subtilis subsp. subtilis 168: BSU05640
Entry
BSU05640          CDS       T00010                                 

Symbol
ydgG
Name
(RefSeq) MarR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MarR MarR_2 HTH_27 HTH_5 HTH_11 HTH_45 DUF4364 HTH_20 TrmB Fe_dep_repress LexA_DNA_bind HTH_24 HTH_34 PadR
Other DBs
NCBI-GeneID: 939880
NCBI-ProteinID: NP_388445
Pasteur: BG12174
BSORF: BG12174
UniProt: P96705 A0A6M3Z881
Position
608933..609391
AA seq 152 aa
MNEQKLCQAINLFVEVLLEGTEFVHREINQDVFKHISREQADLLKILKVKGPTSPGSLAM
YQNVHKSAISNRLKKLLEKGLVQWDDCPEKSDRRSKLINITPSGEHILEELDSAIFNALK
PLIDDIDEEHLHSIIEIFTILKSKFKGGDSAE
NT seq 459 nt   +upstreamnt  +downstreamnt
ttgaatgaacaaaagctatgtcaggcgataaacctgtttgtggaagtcctgcttgaaggg
acagaatttgtgcatcgtgaaatcaatcaggatgtcttcaagcatatctcaagggaacag
gcagacctgttgaaaattttaaaagtcaagggcccaacctctcccggcagcctggccatg
taccaaaatgtacataagagcgcgatctctaacagactgaaaaagctgctcgaaaaggga
ttggttcaatgggacgactgtccggaaaaaagtgataggcgctctaagcttattaacatt
acacccagtggtgaacacatactagaagaattagattctgccatctttaacgcgctcaaa
ccgttgattgatgatatagatgaggaacacttacattctatcatcgagatattcaccatt
ttaaaaagcaaatttaaaggaggagattctgccgaatga

DBGET integrated database retrieval system