KEGG   Bacillus subtilis subsp. subtilis 168: BSU05660
Entry
BSU05660          CDS       T00010                                 

Symbol
ydgI
Name
(RefSeq) NAD(P)H nitroreductase YdgI
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Nitroreductase TM1586_NiRdase Poty_coat
Other DBs
NCBI-GeneID: 938001
NCBI-ProteinID: NP_388447
Pasteur: BG12176
BSORF: BG12176
UniProt: P96707 A0A6M3Z8I6
Position
complement(612191..612820)
AA seq 209 aa
MIKTNDFMEIMKGRRSIRNYDPAVKISKEEMTEILEEATTAPSSVNAQPWRFLVIDSPEG
KEKLAPLASFNQTQVTTSSAVIAVFADMNNADYLEEIYSKAVELGYMPQEVKDRQIAALT
AHFEKLPAQVNRETILIDGGLVSMQLMLTARAHGYDTNPIGGYDKENIAETFGLDKERYV
PVMLLSIGKAADEGYASYRLPIDTIAEWK
NT seq 630 nt   +upstreamnt  +downstreamnt
atgatcaaaacaaacgattttatggaaattatgaaaggccgccgttctatccgcaactat
gatccggcagtaaaaatcagcaaagaagaaatgacagagatcttagaggaagcaacaact
gccccatcttctgttaacgcgcagccatggcgttttcttgtcattgacagcccggaagga
aaagaaaagctcgcaccgcttgcaagctttaaccaaacacaagtcacaacatcatctgct
gtcatcgctgtatttgcagacatgaacaacgcagactatctagaagaaatctattcaaaa
gccgtggaacttggttacatgccgcaggaggtcaaagacagacaaatcgccgcgctgacc
gcacattttgaaaagcttccggcacaggtcaaccgtgaaacgatcctgattgacggaggt
cttgtttccatgcagctgatgctgactgcacgcgcgcatggctacgatacaaacccgatc
ggcggatacgataaagaaaacatcgcggaaaccttcggattagataaagaacgttatgta
ccggttatgctactttctatcggaaaagcagcagacgaaggctatgcttcctaccgtctg
ccgattgatacaattgcagaatggaaataa

DBGET integrated database retrieval system