KEGG   Bacillus subtilis subsp. subtilis 168: BSU05670
Entry
BSU05670          CDS       T00010                                 

Symbol
ydgJ
Name
(RefSeq) MarR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MarR HTH_34 MarR_2 HTH_24 HTH_27 HTH_11 TrmB HTH_5 HTH_20 B-block_TFIIIC TFIIE_alpha HTH_micro LexA_DNA_bind HxlR HTH_45 Mga HTH_12 SMC_ScpB RNA_pol_Rpc34 PadR DNA_ligase_A_N FUR Phage_rep_O HTH_IclR FtsK_gamma HTH_26 DUF6675 HTH_Crp_2 GntR Penicillinase_R Fe_dep_repress GYD
Other DBs
NCBI-GeneID: 938036
NCBI-ProteinID: NP_388448
Pasteur: BG12177
BSORF: BG12177
UniProt: P96708 A0A6M4JFY6
Position
complement(612836..613330)
AA seq 164 aa
MTCQSLIYQLIVLTGKKGWVLASFCSEEAEILYQLQGVNKVIGVKFEACTGISQSRLELL
TLLYHADEISQSDLQKKVNIDSAAVTRHLKQLESKGMVSRRRKPEDNRITLVRLTDQGRE
RIESSKKEKERFMKEMLANVSAEERRLLIDVLARMRNNINNIEA
NT seq 495 nt   +upstreamnt  +downstreamnt
ttgacgtgtcaatcattgatatatcaattaatagttttgacaggaaagaagggatgggtt
ttggcgtcattttgttcagaggaagccgagattttatatcagctgcaaggcgtgaacaag
gtgattggcgtgaagttcgaggcatgcacgggcatcagccaatctcgtttggaattgctg
acattgctttatcatgcagatgagatcagtcaaagcgaccttcaaaagaaagtaaatatc
gatagcgcagccgttaccagacacctgaaacagctggaatccaaaggcatggtatcaagg
cggcgcaagcctgaggacaaccgcatcacccttgttcggttaacagaccaaggaagagag
cgaattgagtcttctaagaaggaaaaggagcgtttcatgaaggaaatgctcgcaaatgta
agcgcagaagaacgccgcctgctcattgatgtgctggcgcgcatgcgaaacaatataaat
aatatcgaagcttaa

DBGET integrated database retrieval system