KEGG   Bacillus subtilis subsp. subtilis 168: BSU05680
Entry
BSU05680          CDS       T00010                                 

Symbol
ydgK
Name
(RefSeq) MFS transporter
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU05680 (ydgK)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    BSU05680 (ydgK)
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_3
Other DBs
NCBI-GeneID: 938060
NCBI-ProteinID: NP_388449
Pasteur: BG12178
BSORF: BG12178
UniProt: P96709 A0A6M4JFU3
Position
613641..614849
AA seq 402 aa
MLHNPTGKERLALAFLLGMLAILGPLNIDMYLPSFPEIAKDLSASASLVQLSLTACLVGL
TIGQLIVGPVSDAQGRRKPLLICIFLFALSSLFCALSPNITTLVAARFLQGFTASAGLVL
SRAIVRDVFTGRELSKFFSLLMVITAVAPMVAPMTGGAILLLPFATWHTIFHVLMIIGFL
LVLLIALRLKETLPLEKRIPSSIGTSVKTMGSLLKDRSFMGYALTVGFIHGGSFAYVSGT
PFVYQDIYGVSPQVFSILFGINGLAIISGSFIIGRFGGIIHEKSLLRIAVITAMIATAVL
LTMTMIHGPLATLVISIFIYMITIGMVLTSTFTLAMEKQGHRAGSASALLGMLPLLLGSI
VSPLVGINETTAVPMGAIMFVTAVIGSLAFFGLTKERVGQNS
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgctgcacaatccaactggaaaagaacgcttggcactagcgtttctgctcggcatgctt
gctatattgggcccgcttaatatagatatgtatttgccaagttttcctgaaatcgcgaaa
gatttatcagcaagtgcttcacttgttcagttaagtttaacagcctgtctggtcgggctt
acgatcggccagctgattgtcgggccggtcagcgatgcgcagggaagacgaaaaccgcta
ttaatctgtatttttttatttgcgttatcttctctgttttgtgcactgtcgcccaatata
acaactttagtggctgcgcgttttttacaaggcttcactgcttctgcagggcttgtgctg
tctcgcgcaatcgtccgcgatgtgtttaccggaagagagctttctaaatttttctcgctg
ttaatggtcattaccgcggtggcgccaatggttgcgcctatgacaggcggtgccattttg
cttttgccgttcgcaacgtggcatacaatttttcacgtcttaatgatcatcggattttta
ctagttcttctgattgcattgaggttaaaagaaacgcttccgctggaaaaacggattcca
agctcaatcggaacatccgtcaaaacgatgggcagcctgctgaaggatcgatcctttatg
gggtacgcgttaactgtcggatttattcacgggggaagctttgcatatgtgtctggtacg
ccttttgtataccaggatatctacggggtgtctccgcaggtatttagtattctttttggc
attaacgggctggcgattatatcgggcagctttatcatcggacgctttggcggaatcatt
catgaaaaaagcctgcttcgtatagcggtcattacggctatgattgcgacggctgtgcta
ttaaccatgaccatgattcacggtcctcttgctacattagtcatatccattttcatttac
atgattacgatcggcatggttctgaccagcacgtttaccctagccatggaaaagcagggg
caccgcgccggaagtgcaagtgcgctgcttggaatgcttccgctgctcctcggttcaatc
gtgtcaccgcttgtaggcattaatgagacaacagccgttccgatgggagccatcatgttt
gtgacagctgtcatcggctcactggcgttttttggattaacgaaagaacgagtagggcag
aattcataa

DBGET integrated database retrieval system