KEGG   Bacillus subtilis subsp. subtilis 168: BSU05690
Entry
BSU05690          CDS       T00010                                 

Symbol
ydhB
Name
(RefSeq) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU05690 (ydhB)
SSDB
Motif
Pfam: TauE
Other DBs
NCBI-GeneID: 939893
NCBI-ProteinID: NP_388450
Pasteur: BG12179
BSORF: BG12179
UniProt: O05493 A0A6M3Z7U8
Position
complement(614885..615622)
AA seq 245 aa
MLIILVMFLLGIILGFIGAGGAGFVIALLTLLFHIPIHTALGTSLAGMAFTSLSGAYSHY
REGNIQMKIGLIVGGFAAVGSFFGAKLTSFIPADLLHYLTAGMLFLSAILILIRLFILKE
KAQVNQSTLSTYTRAVILGIAAGVLSGTFGIGSAPFIQIGLMIMLNLSIRHSVGTTMLVI
IPLAVGGGIGYITEGFVDYVLLVKVLVGTMCGAYVGAKFTNLMPKVVLKSAIFLTPAIAG
LLLLF
NT seq 738 nt   +upstreamnt  +downstreamnt
atgctcattattcttgttatgtttcttctaggaattattttaggctttattggcgccggt
ggagccggctttgtcattgcccttttaacgcttcttttccatatcccgattcatacggct
ttaggcacttcgcttgccggcatggcttttacaagcttatcaggggcatacagccactat
cgcgagggtaacattcaaatgaaaatcggcttaatagtcggaggctttgctgcggttggc
tcatttttcggcgccaagctgacttcttttattccggctgatttgcttcattatttgacg
gctggaatgttatttttatcagcaattctcattttaatcagattatttattttaaaagag
aaggctcaagtgaatcaaagcactctttcaacgtatacgagagcggtcatcttaggaatt
gcagccggcgttctttccggcacattcggcatcgggtcggcaccttttattcaaatcggt
ttaatgattatgctgaatctgtccattcgccattctgtcggaacgacgatgcttgtgatc
atccctctggctgtaggtggaggcatcggatatattacagaaggttttgttgattacgtt
ttacttgtcaaagttctggtcgggacaatgtgcggggcctatgtaggcgcgaaattcacc
aacctcatgccaaaggtggttttgaaatcagccatctttttgactccggcgattgcaggc
ctgctgttgttattctaa

DBGET integrated database retrieval system