KEGG   Bacillus subtilis subsp. subtilis 168: BSU05700
Entry
BSU05700          CDS       T00010                                 

Symbol
ydhC
Name
(RefSeq) GntR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: FCD GntR HTH_24 HTH_Crp_2 HTH_11 Rrf2 Ribosomal_S19e HTH_29 MarR Fe_dep_repress PaaX HTH_41 Peptidase_C50
Other DBs
NCBI-GeneID: 938042
NCBI-ProteinID: NP_388451
Pasteur: BG12180
BSORF: BG12180
UniProt: O05494 A0A6M3Z800
Position
615871..616545
AA seq 224 aa
MDDFKLDKPTPYYLQFYNQLKKMIFNGTFKPGERINETQLAKSFGVSRSPIREAMRLLEK
DGLLKADDRNGFSITSLTAKDVDEIYKIRIPLEQLAVELVIDEADEEELTILEKQLEETE
KAIHNGTEDTEIIRLNQKFHELLVDFSHNRHLKNLLEHVNDLIHFCRILNYTGDHRAETI
LREHRRIFEEVKKKNKEAAKQHVLAHFNHDCEHLKHVLEEGKEN
NT seq 675 nt   +upstreamnt  +downstreamnt
atggacgattttaaattagataagccgactccctactacctgcaattttataaccagcta
aaaaaaatgatcttcaacgggacttttaagcctggggaacggataaacgaaacacagctg
gcgaaaagctttggcgtcagccgctctccgataagggaagccatgcgattgcttgagaaa
gatggtttgttaaaagcggatgaccgaaatgggttttcgatcacgtcgttaacggcaaaa
gatgtagatgagatttataaaatcagaattccgctggagcagctggcagtcgaattagtc
atagacgaagcggacgaagaagagctgaccatactcgaaaaacagcttgaagaaacagag
aaagcgattcacaacggcacggaagatacagaaatcattcgtttaaaccaaaaatttcat
gagctgctggttgatttcagccataacagacatttgaaaaatttgcttgagcatgtaaat
gacctgattcatttttgcagaatccttaattataccggcgaccaccgcgcagaaacgata
ctgcgtgagcaccgcaggatatttgaagaagtgaaaaagaaaaacaaagaagcagccaaa
caacatgtgctggctcatttcaatcatgactgtgagcatttgaagcatgtgcttgaagaa
ggtaaagagaattga

DBGET integrated database retrieval system