KEGG   Bacillus subtilis subsp. subtilis 168: BSU05710
Entry
BSU05710          CDS       T00010                                 

Symbol
ydhD
Name
(RefSeq) sporulation protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Glyco_hydro_18 LysM
Other DBs
NCBI-GeneID: 939885
NCBI-ProteinID: NP_388452
Pasteur: BG12181
BSORF: BG12181
UniProt: O05495 A0A6M3Z815
Structure
PDB: 
3CZ8

Position
616672..617934
AA seq 420 aa
MFIHIVGPGDSLFSIGRRYGASVDQIRGVNGLDETNIVPGQALLIPLYVYTVQPRDTLTA
IAAKAFVPLERLRAANPGISPNALQAGAKITIPSISNYIAGTLSFYVLRNPDLDRELIND
YAPYSSSISIFEYHIAPNGDIANQLNDAAAIETTWQRRVTPLATITNLTSGGFSTEIVHQ
VLNNPTARTNLVNNIYDLVSTRGYGGVTIDFEQVSAADRDLFTGFLRQLRDRLQAGGYVL
TIAVPAKTSDNIPWLRGYDYGGIGAVVNYMFIMAYDWHHAGSEPGPVAPITEIRRTIEFT
IAQVPSRKIIIGVPLYGYDWIIPYQPGTVASAISNQNAIERAMRYQAPIQYSAEYQSPFF
RYSDQQGRTHEVWFEDVRSMSRKMQIVREYRLQAIGAWQLTLGFTPGPWLLRKFFTIRKV
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgtttatccatatcgtcgggcctggtgattctttgttttcgataggcagaagatacggt
gcttctgttgatcaaatacggggtgtgaatggtttagatgaaacgaatatcgtgccgggg
caggctctgcttatccctctttatgtatatacagtccagccgagagatacgcttaccgcc
attgcagctaaagcgtttgtgccattagagcgactgcgagcggccaatccgggcatcagc
ccaaatgctttacaagcgggagcaaaaataacgattccttcgatctcaaattacattgcg
ggaacgttaagtttttatgtgctccgaaacccagacctcgatcgggaattaatcaatgat
tatgcgccatactcgtcttcgatttcaattttcgaataccatattgcaccgaacggcgac
attgcaaaccaattgaatgatgcggccgctattgagacaacttggcaaagacgagtcacg
ccgctggcaacaataacgaaccttacatcaggaggcttcagtacggagattgttcaccaa
gtgctaaacaatccgacagcgagaaccaatctggtcaacaacatttatgacttagtttcc
acaaggggatatggcggtgtcacaatcgattttgagcaggtgagcgccgcggatcgcgat
cttttcactggatttttacgccagctgagagatcgacttcaggcgggagggtatgtgctg
acgatagctgttcctgcaaaaacaagtgataatatcccatggctgaggggctacgattac
ggggggataggagcggttgtcaattatatgtttatcatggcttatgattggcatcatgcg
ggaagtgagccgggtcctgtagcgccgattactgaaataaggagaaccattgagtttacg
attgcgcaggtgccgagcagaaaaatcattatcggagtcccgctctacgggtacgactgg
atcatcccgtaccagccgggcacagttgcttcagcgatttcaaatcaaaacgcaatcgaa
agagcgatgaggtaccaagccccgatacaatattcagccgaatatcaatcaccgtttttc
cggtacagtgatcagcaggggcggacgcatgaggtatggtttgaggatgtcagaagcatg
agccggaagatgcagatcgtccgtgaatacagattgcaggctattggcgcttggcagtta
acgctgggctttacgccgggcccatggcttctgcggaaattttttacgatcagaaaagtg
taa

DBGET integrated database retrieval system