KEGG   Bacillus subtilis subsp. subtilis 168: BSU05720
Entry
BSU05720          CDS       T00010                                 

Symbol
ydhE
Name
(RefSeq) UDP-glucosyltransferase YdhE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_4_2 Glyco_transf_28
Other DBs
NCBI-GeneID: 939868
NCBI-ProteinID: NP_388453
Pasteur: BG12182
BSORF: BG12182
UniProt: O05496 A0A6M4JKL9
Position
618095..619282
AA seq 395 aa
MKTVLILNFPAEGHVNPTLGITKAFSDKGYDVHYISTEKYKKRLEAAGATVHLHRDLLRT
TPIHVGSPNGILDFVKIHIKTSLDILQIVKDLSKSIQFDFVYYDKFGAGELVRDYLDIPG
VSSSASFLFGEEHLKILPLHPESGAPLELDQECEDLLAKMKETYGVAPKNLVQFMNNKGE
LNVVYTSRYFQPESDRFGDECLFIGPSFPKRAEKTDFPIEQLKDEKVIYISMGTVLDHTE
DFFNLCIDAFSGFNGKVVIAAGEKADLTKLKQAPENFIIAPYVPQLEVLEQSDVFITHGG
MNSVNEGIHFSVPLVVMPHDKDQPMVAQRLSELHAGYVISKDEVNAQILKQAVDEVLRND
QYTAGIKKINQSFKECMDMEEVMERIDELIRQKNK
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgaagacagtattgattttgaattttcctgcggaaggccatgtgaatcctactttaggc
attacgaaagcgttttccgataagggatatgatgtccattatatatccactgaaaaatat
aaaaaacgattagaagcagcgggagcaacggtccatcttcaccgggatctgctgcgaacg
acacctattcatgtcggttcgcccaatggcattcttgatttcgtgaaaatccatatcaaa
acgtcattggacattttacagattgtcaaagacttatctaagagcattcaatttgatttt
gtttattatgataaattcggcgcgggggaattggtgagggattacttagatattccaggg
gtctcttcatcggcgtctttcctgtttggcgaggagcatctgaaaatcctgccgctgcat
ccggagtctggagcgccgcttgaattggatcaagagtgcgaagaccttttggcaaaaatg
aaagaaacgtacggtgttgccccgaaaaacctggttcaattcatgaacaataaaggggaa
ttgaacgtagtgtatacaagccgttattttcagccagaaagtgatcgtttcggggatgaa
tgtctatttatcgggccgagctttccaaagagagcggaaaaaacagatttcccgattgaa
cagctaaaagatgagaaggtcatttatatttcaatggggactgtactggatcatacagag
gatttcttcaacctttgtattgatgcattttcaggctttaacggaaaagtcgtcatcgct
gccggagaaaaagcggacctgaccaaattaaagcaggcgccggaaaactttatcattgct
ccgtatgtccctcagctggaagtgctggagcaatcggatgttttcattacacacggcgga
atgaacagcgtaaacgaaggcattcatttcagcgtgccactggttgtcatgcctcatgac
aaggatcagccgatggtggcgcagcgtctctctgaactccatgcaggctatgtcatctct
aaagatgaagtcaatgcccaaatattaaaacaggccgtagatgaggttttgcgcaacgat
cagtatacggcaggcattaaaaaaatcaatcaaagcttcaaagaatgtatggacatggaa
gaagtgatggagcggattgatgagttgattcgccaaaaaaacaaataa

DBGET integrated database retrieval system