KEGG   Bacillus subtilis subsp. subtilis 168: BSU05730
Entry
BSU05730          CDS       T00010                                 

Symbol
ydhF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4352 LPAM_1
Other DBs
NCBI-GeneID: 938019
NCBI-ProteinID: NP_388454
Pasteur: BG12183
BSORF: BG12183
UniProt: O05497 A0A6M4JJ05
Position
complement(619321..620031)
AA seq 236 aa
MRRILSILVFAIMLAGCSSNASTEKQHAGGEKTVKAEPQSTSSQKDSTDDYQPNSQVTDD
RTLHKVGQTFSDDKGKAVLKDIKQVNKTYKIGDVELTVKEMKLIHLRPDYSMIDYFHELT
HDEEFDFVKVFVDIKNTSTKKVNVAPIALMKTNTGETFDWNKDIYLEELNGELEGGAEKS
GNLGFIVNASSGHAHDKAADAEKKTKEIKWIEITTSDVFDHNHKKISDAQKIKIKF
NT seq 711 nt   +upstreamnt  +downstreamnt
atgagaagaattctttcaattctcgtttttgctatcatgcttgcgggctgctcatcaaac
gccagtactgaaaaacagcatgcaggcggggagaaaacagtaaaagctgagccgcaaagc
acttcatcccagaaggacagcacagatgattatcagcctaattcccaggtaactgatgac
cggacattgcataaggtcggccaaacgttttcagatgataaaggaaaagctgtcttaaaa
gatatcaaacaagtgaacaaaacctataaaattggcgacgtggagttaacagtaaaagaa
atgaagctgatccacttgcgcccggactacagcatgattgattactttcatgagttaaca
cacgatgaagagtttgatttcgttaaggttttcgttgatatcaagaacacctctacaaaa
aaagtaaatgttgcgccgattgcattgatgaaaacaaatacgggtgaaacctttgattgg
aacaaagatatttatcttgaagagttaaacggcgaattggaaggcggcgccgaaaagtcc
ggaaatctcggctttattgtgaacgcatcaagcggccatgctcatgataaggccgcggat
gctgagaagaaaacaaaagagatcaagtggatcgaaatcacgacaagtgacgtctttgac
cataaccataagaaaatcagtgatgctcaaaaaatcaaaatcaagttttaa

DBGET integrated database retrieval system