KEGG   Bacillus subtilis subsp. subtilis 168: BSU05740
Entry
BSU05740          CDS       T00010                                 

Symbol
phoB
Name
(RefSeq) alkaline phosphatase 3
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu00790  Folate biosynthesis
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
bsu02020  Two-component system
Module
bsu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU05740 (phoB)
   00790 Folate biosynthesis
    BSU05740 (phoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU05740 (phoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU05740 (phoB)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bsu00537]
    BSU05740 (phoB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BSU05740 (phoB)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSU05740 (phoB)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bsu00537]
 Enzymes
  BSU05740 (phoB)
SSDB
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase NAD_binding_7
Other DBs
NCBI-GeneID: 938004
NCBI-ProteinID: NP_388455
Pasteur: BG10697
BSORF: BG10697
UniProt: P19405 A0A6M3Z893
Position
complement(620097..621485)
AA seq 462 aa
MKKFPKKLLPIAVLSSIAFSSLASGSVPEASAQEKKKGNQDEIKNVIVLIGDGMGVSYTS
AYRYLKDNKKTKVVEPTAFDQYLVGQQTTYPDDPEQNVTDSAAAATAMSAGIKTYNNAIA
VDNDGSEAKTVLEAAKEKGKATGLVATSEITHATPASFGSHDHSRKNMNSIADDYFDEMV
NGKHKIDVLLGGGKSNFDRKDRNLIKEFKKAGYSYVDDRKDMLKNKDSQVLGLFADGGLP
KKIDRTKDIPSLKDMTNTAIKKLNKDKDGFFLMVEGSQIDWAGHDNDIVGAMSEMEDFEQ
AYKAAIDFAKKDKHTLVVATADHSTGGYSIGADGIYNWFSEPIKAAKRTPDFMAEKIADG
ADVEKTLKTYIDQKKLALTKAEIQSVEEAAKSKEVLDIDNAIENIFNKRSHTGWTTGGHT
GEDVPVYAYGPSSETFAGQIDNTEIAKNVFKALQYNIKINDK
NT seq 1389 nt   +upstreamnt  +downstreamnt
ttgaaaaaattcccgaagaaattactgcctatcgcggttttatcatcaattgcgttcagc
agcttagccagcggcagtgtgcctgaagccagcgcccaggaaaagaaaaaggggaaccaa
gacgaaattaaaaatgttattgttctgattggtgatggtatgggtgtgtcttatacgtct
gcttatcgatacttaaaggataataaaaagacaaaagttgtggagcctacggcttttgat
cagtatcttgtcggccagcaaacaacttaccccgatgatcctgaacaaaatgtaacggat
tctgcagcggcggcaacggctatgtctgcgggaattaaaacatacaataatgccatagcc
gttgataacgacgggtcagaagccaaaacggtgcttgaagctgcgaaagaaaaaggaaaa
gcaacaggacttgtggccacttcagaaattacacacgccactccggcctcttttggttca
cacgaccacagccgaaaaaatatgaactcaattgcggatgattattttgatgagatggtc
aacggcaagcacaaaattgatgtccttctaggcggaggaaagagcaattttgaccgtaag
gaccgtaatttgattaaggaattcaaaaaggcggggtacagctacgtggatgatcgcaag
gacatgctgaaaaacaaagacagccaagttctcggcctattcgctgacggcggcctgcct
aaaaagattgaccgtacgaaggatattccatcacttaaagatatgacaaacacagccatt
aaaaaattaaacaaggataaagacggattcttcctcatggtggaaggcagccagattgac
tgggcgggccatgacaatgatatcgttggcgccatgagcgagatggaagacttcgaacaa
gcttataaggcggctattgatttcgctaaaaaagacaagcacacattggttgtcgcaacg
gctgaccactcaaccggcggatattccatcggtgcggacggcatctacaactggttcagt
gaacccattaaagccgcaaagcgcacaccagactttatggcagaaaagatcgctgacggc
gcggatgttgaaaaaacgttgaaaacatatatcgatcaaaagaaattggctttaacaaaa
gccgaaattcaatctgttgaagaagcggcaaaatcgaaggaagtactggatatcgataac
gcaatcgagaacatctttaataaacgctctcacactggatggacaacaggcggacatacc
ggtgaagatgttcccgtctatgcatacggtccgtctagtgagacatttgccggccaaatc
gacaatacagaaatcgccaaaaatgttttcaaggctttacaatacaacattaagattaac
gataagtaa

DBGET integrated database retrieval system