KEGG   Bacillus subtilis subsp. subtilis 168: BSU05750
Entry
BSU05750          CDS       T00010                                 

Symbol
ydhG
Name
(RefSeq) hypothetical protein
  KO
K05937  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU05750 (ydhG)
SSDB
Motif
Pfam: DUF1801 DUF5655
Other DBs
NCBI-GeneID: 938031
NCBI-ProteinID: NP_388456
Pasteur: BG12184
BSORF: BG12184
UniProt: Q797E6 A0A6M4JDJ1
Structure
Position
621847..622218
AA seq 123 aa
MDVFSEYLAGIADPFHRERTEEVLTWIKNKYPNLHTEIKWNQPMFTDHGTFIIGFSVSKK
HLAVAPEKVTIAHVEDDIVKAGYDYTEQLIRIPWNGPVDYTLLEKMIEFNILDKADCSTF
WRK
NT seq 372 nt   +upstreamnt  +downstreamnt
atggacgttttttctgagtacttagcggggattgctgacccgttccaccgagaaagaacg
gaagaggtgttaacttggataaaaaataaatatccaaatttacatacagaaataaaatgg
aatcagccgatgtttacggatcacggtacatttattattggctttagtgtttctaaaaag
catttagctgtcgctcctgaaaaagtaacgatagcgcacgtagaggatgatattgtgaag
gccggatatgattacaccgagcagctgatacgtatcccttggaacggtccagttgattat
acgctacttgagaaaatgattgagtttaatattctggacaaggcggactgctccactttt
tggcggaaatga

DBGET integrated database retrieval system