KEGG   Bacillus subtilis subsp. subtilis 168: BSU05770
Entry
BSU05770          CDS       T00010                                 

Symbol
ydhI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_4 FR47 Acetyltransf_3 DEDD_Tnp_IS110
Other DBs
NCBI-GeneID: 939866
NCBI-ProteinID: NP_388458
Pasteur: BG12186
BSORF: BG12186
UniProt: O05501 A0A6M4JG01
Position
complement(622808..623290)
AA seq 160 aa
MMIIIPNNEIAKHMLTDFFAKHWGTPEMAISSGIFRCDELDGFAAVNESGEIIGCITYTI
DGKDCEIISLDSMIENKGIGTALLQQVEEKAKHAHCQRIKLITTNDNVNAIAFYQKRGYQ
FAAVFPNAVEKARRLKPEIPEVAENGILIRDEILFSKVID
NT seq 483 nt   +upstreamnt  +downstreamnt
atgatgatcatcatcccaaacaatgagatagcgaaacatatgttgaccgatttttttgcc
aagcattggggtacacccgagatggcgatttccagcggcatttttcggtgtgatgaatta
gatggatttgccgcagtaaatgaaagcggcgaaatcattggctgtattacatacacaata
gatgggaaagattgtgaaattatttcattagatagtatgattgaaaataaaggaatcggc
acagctttacttcagcaggttgaagagaaggctaaacatgcacattgtcaacgaataaag
cttatcacaacgaatgataatgtaaatgcgatagcgttttatcaaaagagaggctatcaa
ttcgccgcagtgtttccgaacgcagttgaaaaagcgcgccgactcaagccggagattccc
gaggtggctgaaaacggcattttgattcgggatgaaattctattttcgaaggtaattgat
taa

DBGET integrated database retrieval system